BLASTX nr result
ID: Salvia21_contig00015582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015582 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147640.1| PREDICTED: 50S ribosomal protein L18, chloro... 91 1e-16 ref|XP_002509912.1| 50S ribosomal protein L18, chloroplast precu... 90 2e-16 ref|NP_175268.1| 50S ribosomal protein L18 [Arabidopsis thaliana... 89 4e-16 ref|XP_002891426.1| ribosomal protein L18 family protein [Arabid... 89 4e-16 ref|XP_002270923.1| PREDICTED: 50S ribosomal protein L18, chloro... 88 8e-16 >ref|XP_004147640.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Cucumis sativus] gi|449498793|ref|XP_004160635.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Cucumis sativus] Length = 170 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -3 Query: 209 AKKVGEAIAKACIEKGITKVAFDRGGYPYHGRIEALANAAREQGLQF 69 AKK+GEAIAK+C+EKGITKVAFDRGGYPYHGR+EALA+AARE GLQF Sbjct: 124 AKKIGEAIAKSCLEKGITKVAFDRGGYPYHGRVEALADAAREHGLQF 170 >ref|XP_002509912.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus communis] gi|223549811|gb|EEF51299.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus communis] Length = 164 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 209 AKKVGEAIAKACIEKGITKVAFDRGGYPYHGRIEALANAAREQGLQF 69 AKKVGE IAK+C+EKGITKVAFDRGGYPYHGRIEALA+AARE GLQF Sbjct: 118 AKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALADAARENGLQF 164 >ref|NP_175268.1| 50S ribosomal protein L18 [Arabidopsis thaliana] gi|73621536|sp|Q9SX68.1|RK18_ARATH RecName: Full=50S ribosomal protein L18, chloroplastic; AltName: Full=CL18; Flags: Precursor gi|5733872|gb|AAD49760.1|AC007932_8 Similar to 50S Ribosomal protein L18 from Thermotoga maritima gb|AE001798. ESTs gb|AI993387, gb|T75951 and gb|T22182 come from this gene [Arabidopsis thaliana] gi|12484209|gb|AAG54003.1|AF336922_1 putative ribosomal protein L18 [Arabidopsis thaliana] gi|110740956|dbj|BAE98573.1| hypothetical protein [Arabidopsis thaliana] gi|332194156|gb|AEE32277.1| 50S ribosomal protein L18 [Arabidopsis thaliana] Length = 170 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -3 Query: 209 AKKVGEAIAKACIEKGITKVAFDRGGYPYHGRIEALANAAREQGLQF 69 AKKVGE IAK+C+EKGITKVAFDRGGYPYHGRIEALA AARE GLQF Sbjct: 124 AKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAREHGLQF 170 >ref|XP_002891426.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. lyrata] gi|297337268|gb|EFH67685.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. lyrata] Length = 170 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -3 Query: 209 AKKVGEAIAKACIEKGITKVAFDRGGYPYHGRIEALANAAREQGLQF 69 AKKVGE IAK+C+EKGITKVAFDRGGYPYHGRIEALA AARE GLQF Sbjct: 124 AKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAREHGLQF 170 >ref|XP_002270923.1| PREDICTED: 50S ribosomal protein L18, chloroplastic isoform 2 [Vitis vinifera] Length = 131 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 209 AKKVGEAIAKACIEKGITKVAFDRGGYPYHGRIEALANAAREQGLQF 69 AKKVGE IA AC+EKGITKVAFDRGGYPYHGR++ALA+AARE+GLQF Sbjct: 85 AKKVGEVIASACLEKGITKVAFDRGGYPYHGRVKALADAAREKGLQF 131