BLASTX nr result
ID: Salvia21_contig00013163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00013163 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278753.2| PREDICTED: serine/threonine protein phosphat... 78 7e-13 emb|CBI15001.3| unnamed protein product [Vitis vinifera] 78 7e-13 ref|XP_002321613.1| predicted protein [Populus trichocarpa] gi|2... 76 2e-12 ref|XP_002516465.1| protein phosphatase pp2a regulatory subunit ... 76 3e-12 ref|NP_564595.1| protein phosphatase 2 (formerly 2A), regulatory... 75 4e-12 >ref|XP_002278753.2| PREDICTED: serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform-like [Vitis vinifera] Length = 507 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 143 QFDYLRSVEIEEKINKVRWCAASTGSLHILSSNDKTIKLWKVKDRQ 6 +FDYLRS+EIEEKINKVRWCA SL ILS+NDKTIKLWKVKD + Sbjct: 101 EFDYLRSLEIEEKINKVRWCATPNESLFILSTNDKTIKLWKVKDHK 146 >emb|CBI15001.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 143 QFDYLRSVEIEEKINKVRWCAASTGSLHILSSNDKTIKLWKVKDRQ 6 +FDYLRS+EIEEKINKVRWCA SL ILS+NDKTIKLWKVKD + Sbjct: 97 EFDYLRSLEIEEKINKVRWCATPNESLFILSTNDKTIKLWKVKDHK 142 >ref|XP_002321613.1| predicted protein [Populus trichocarpa] gi|222868609|gb|EEF05740.1| predicted protein [Populus trichocarpa] Length = 520 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/47 (68%), Positives = 43/47 (91%) Frame = -2 Query: 143 QFDYLRSVEIEEKINKVRWCAASTGSLHILSSNDKTIKLWKVKDRQV 3 +FDYL+S+EIEEKIN+V+WC+ S GSL ILS+NDKTIKLWKV ++++ Sbjct: 109 EFDYLKSMEIEEKINRVKWCSTSNGSLFILSTNDKTIKLWKVSEKKL 155 >ref|XP_002516465.1| protein phosphatase pp2a regulatory subunit B, putative [Ricinus communis] gi|223544285|gb|EEF45806.1| protein phosphatase pp2a regulatory subunit B, putative [Ricinus communis] Length = 513 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/47 (65%), Positives = 43/47 (91%) Frame = -2 Query: 143 QFDYLRSVEIEEKINKVRWCAASTGSLHILSSNDKTIKLWKVKDRQV 3 +FDYLRS+EIEEKINK+RWC ++ G+L +LS+NDKTIK WKV++++V Sbjct: 104 EFDYLRSLEIEEKINKIRWCQSANGALFLLSTNDKTIKFWKVQEKKV 150 >ref|NP_564595.1| protein phosphatase 2 (formerly 2A), regulatory subunit B [Arabidopsis thaliana] gi|85680895|sp|Q38821.2|2ABA_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform; Short=AtB alpha; Short=PP2A, subunit B, alpha isoform gi|21539523|gb|AAM53314.1| type 2A protein serine/threonine phosphatase 55 kDa B regulatory subunit [Arabidopsis thaliana] gi|23197802|gb|AAN15428.1| type 2A protein serine/threonine phosphatase 55 kDa B regulatory subunit [Arabidopsis thaliana] gi|110740433|dbj|BAF02111.1| 55 kDa B regulatory subunit of phosphatase 2A [Arabidopsis thaliana] gi|332194580|gb|AEE32701.1| protein phosphatase 2 (formerly 2A), regulatory subunit B [Arabidopsis thaliana] Length = 513 Score = 75.5 bits (184), Expect = 4e-12 Identities = 30/47 (63%), Positives = 42/47 (89%) Frame = -2 Query: 143 QFDYLRSVEIEEKINKVRWCAASTGSLHILSSNDKTIKLWKVKDRQV 3 +FDYL+S+EIEEKINK+RWC + G+L +LS+NDKTIK WKV+D+++ Sbjct: 104 EFDYLKSLEIEEKINKIRWCQTANGALFLLSTNDKTIKFWKVQDKKI 150