BLASTX nr result
ID: Salvia21_contig00009801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009801 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [G... 65 6e-09 ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]... 62 5e-08 ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [V... 62 6e-08 ref|XP_003544409.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [G... 62 6e-08 emb|CBI32597.3| unnamed protein product [Vitis vinifera] 62 6e-08 >ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max] Length = 513 Score = 65.1 bits (157), Expect = 6e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -2 Query: 262 KCNSAVWVALKNVQPANNGPWEDCIHKYPIQLL 164 KCNSAVW AL+NV+P+ NGPWEDCIHKYP++++ Sbjct: 480 KCNSAVWQALRNVRPSPNGPWEDCIHKYPVEIV 512 >ref|XP_002510394.1| acyltransferase, putative [Ricinus communis] gi|223551095|gb|EEF52581.1| acyltransferase, putative [Ricinus communis] Length = 502 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -2 Query: 262 KCNSAVWVALKNVQPANNGPWEDCIHKYPIQLL 164 KCNSAVW AL+NV+P+ NGPWEDCI KYP++L+ Sbjct: 469 KCNSAVWEALRNVKPSPNGPWEDCIDKYPVKLV 501 >ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Vitis vinifera] Length = 504 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -2 Query: 262 KCNSAVWVALKNVQPANNGPWEDCIHKYPIQLL 164 KCNSAVW AL+NV P+ NGPWEDCI+KYP++++ Sbjct: 471 KCNSAVWQALRNVNPSPNGPWEDCINKYPVEVV 503 >ref|XP_003544409.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max] gi|426281414|gb|AFY23861.1| 3-ketoacyl-CoA synthase [Glycine max] Length = 510 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -2 Query: 262 KCNSAVWVALKNVQPANNGPWEDCIHKYPIQLL 164 KCNSAVW AL+NV+P+ NGPWEDCI KYP++++ Sbjct: 477 KCNSAVWQALRNVRPSPNGPWEDCIDKYPVEIV 509 >emb|CBI32597.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -2 Query: 262 KCNSAVWVALKNVQPANNGPWEDCIHKYPIQLL 164 KCNSAVW AL+NV P+ NGPWEDCI+KYP++++ Sbjct: 218 KCNSAVWQALRNVNPSPNGPWEDCINKYPVEVV 250