BLASTX nr result
ID: Salvia21_contig00007500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00007500 (1050 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521083.1| conserved hypothetical protein [Ricinus comm... 70 7e-10 ref|XP_003548682.1| PREDICTED: uncharacterized protein LOC100818... 61 4e-07 ref|XP_002265149.1| PREDICTED: uncharacterized protein LOC100262... 59 2e-06 ref|XP_003530861.1| PREDICTED: uncharacterized protein LOC100500... 58 3e-06 ref|XP_003626974.1| hypothetical protein MTR_8g013640 [Medicago ... 58 4e-06 >ref|XP_002521083.1| conserved hypothetical protein [Ricinus communis] gi|223539652|gb|EEF41234.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 70.5 bits (171), Expect = 7e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 611 RGSQRERDRVRAQARAGQKPRNPKDDGLTLEQRRERD 721 RG+QRERDR RAQARAGQKP+NPKDDGLT EQRRERD Sbjct: 12 RGNQRERDRERAQARAGQKPKNPKDDGLTPEQRRERD 48 >ref|XP_003548682.1| PREDICTED: uncharacterized protein LOC100818846 [Glycine max] Length = 147 Score = 61.2 bits (147), Expect = 4e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 596 FDLC*RGSQRERDRVRAQARAGQKPRNPKDDGLTLEQRRERD 721 F L RG+QRERDR RAQARAG K + PK+DGLT EQRRERD Sbjct: 79 FILSQRGNQRERDRERAQARAGGKTKQPKNDGLTPEQRRERD 120 >ref|XP_002265149.1| PREDICTED: uncharacterized protein LOC100262707 [Vitis vinifera] Length = 80 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 605 C*RGSQRERDRVRAQARAGQKPRNPKDDGLTLEQRRERD 721 C RG+QR+RDR RAQAR G K + KDDGLT EQRRERD Sbjct: 5 CERGNQRDRDRERAQARIGHKSKQAKDDGLTPEQRRERD 43 >ref|XP_003530861.1| PREDICTED: uncharacterized protein LOC100500049 [Glycine max] Length = 76 Score = 58.2 bits (139), Expect = 3e-06 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 584 VCFFFDLC*RGSQRERDRVRAQARAGQKPRNPKDDGLTLEQRRERD 721 V FF + RGSQR+RDR RAQAR G K + KDDGLT EQRRERD Sbjct: 6 VLFFLSISARGSQRDRDRERAQARTGAKGKQ-KDDGLTPEQRRERD 50 >ref|XP_003626974.1| hypothetical protein MTR_8g013640 [Medicago truncatula] gi|355520996|gb|AET01450.1| hypothetical protein MTR_8g013640 [Medicago truncatula] Length = 199 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 611 RGSQRERDRVRAQARAGQKPRNPKDDGLTLEQRRERD 721 RG+QRERDR RAQARA QK + K+DGLT EQRRERD Sbjct: 134 RGNQRERDRERAQARANQKSKQSKNDGLTPEQRRERD 170