BLASTX nr result
ID: Salvia21_contig00007349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00007349 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] 86 2e-15 gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] 84 9e-15 ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinif... 70 2e-10 emb|CBI19611.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinif... 67 2e-09 >gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] Length = 534 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +1 Query: 1 MHMLHLVLANLLQAFELSTVCDEGVDMSESAGMTNLKATPLDVLVAPRLSPTLY*E 168 + MLHLVLA+LLQAF++STV DE VDMSESAG+TN+KATPLDV+V PRL P LY E Sbjct: 474 LQMLHLVLASLLQAFDMSTVSDEAVDMSESAGLTNMKATPLDVVVTPRLPPRLYNE 529 >gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] Length = 516 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +1 Query: 1 MHMLHLVLANLLQAFELSTVCDEGVDMSESAGMTNLKATPLDVLVAPRLSPTLY 162 + MLHLVLA+LLQAF+LS V +E +DMSESAG+TN+KATPLDVL+APRL P+LY Sbjct: 462 LQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLIAPRLPPSLY 515 >ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Length = 731 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +1 Query: 1 MHMLHLVLANLLQAFELSTVCDEGVDMSESAGMTNLKATPLDVLVAPRLSPTLY 162 + + LA+L+Q FE +T+ DE VDM+ES G+TNLKATPL+VLVAPRLS LY Sbjct: 677 LQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNLKATPLEVLVAPRLSSDLY 730 >emb|CBI19611.3| unnamed protein product [Vitis vinifera] Length = 929 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = +1 Query: 1 MHMLHLVLANLLQAFELSTVCDEGVDMSESAGMTNLKATPLDVLVAPRLSPTLY 162 + L LA+L+Q FE +T D VDM+ES G+TNLKATPLDVL+ PRLS LY Sbjct: 466 LQFLQFTLASLIQGFEFATASDGPVDMTESIGLTNLKATPLDVLLTPRLSSNLY 519 >ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +1 Query: 1 MHMLHLVLANLLQAFELSTVCDEGVDMSESAGMTNLKATPLDVLVAPRLSPTLY 162 + +LHL LA LL AFELST D+ VDM+ES+G+T KATPL+VL+ PRL+ LY Sbjct: 472 LQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPLEVLLTPRLNSKLY 525