BLASTX nr result
ID: Salvia21_contig00007045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00007045 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281393.1| PREDICTED: UPF0405 protein C3orf75 homolog [... 63 2e-08 ref|XP_002312051.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|NP_567351.1| elongator protein 6 [Arabidopsis thaliana] gi|7... 59 5e-07 dbj|BAH57122.1| AT4G10090 [Arabidopsis thaliana] 59 5e-07 ref|XP_002872489.1| predicted protein [Arabidopsis lyrata subsp.... 58 7e-07 >ref|XP_002281393.1| PREDICTED: UPF0405 protein C3orf75 homolog [Vitis vinifera] gi|297736457|emb|CBI25328.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +3 Query: 3 DVHGQLTVSNRNLRLGSGKSRSRVHNFQFRIKDSNVEYFYPGSKT 137 DVHGQLTV N+ + G G SR+R HNF F++K+++VE FYPG++T Sbjct: 212 DVHGQLTVLNKGICEGQGNSRNRTHNFHFKVKENSVECFYPGTRT 256 >ref|XP_002312051.1| predicted protein [Populus trichocarpa] gi|222851871|gb|EEE89418.1| predicted protein [Populus trichocarpa] Length = 261 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = +3 Query: 3 DVHGQLTVSNRNLRLGSGKSRSRVHNFQFRIKDSNVEYFYPGSKT 137 DVHGQLTV NR+ G S++++ NF F++K+++VEYFYPG++T Sbjct: 217 DVHGQLTVLNRDFCNVKGSSKNKISNFHFKVKENSVEYFYPGTRT 261 >ref|NP_567351.1| elongator protein 6 [Arabidopsis thaliana] gi|75154680|sp|Q8L9Y2.1|ELP6_ARATH RecName: Full=Elongator complex protein 6; Short=AtELP6; AltName: Full=Elongator component 6; AltName: Full=UPF0405 protein ELP6 gi|21593728|gb|AAM65695.1| unknown [Arabidopsis thaliana] gi|87116610|gb|ABD19669.1| At4g10090 [Arabidopsis thaliana] gi|110735719|dbj|BAE99839.1| hypothetical protein [Arabidopsis thaliana] gi|332657437|gb|AEE82837.1| elongator protein 6 [Arabidopsis thaliana] Length = 262 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 3 DVHGQLTVSNRNL-RLGSGKSRSRVHNFQFRIKDSNVEYFYPGSKT 137 DVHGQLTV N+ + G G SR+++ NFQFRIK++ ++YFYPG ++ Sbjct: 217 DVHGQLTVLNKGISNSGRGSSRNKLQNFQFRIKENGIDYFYPGCRS 262 >dbj|BAH57122.1| AT4G10090 [Arabidopsis thaliana] Length = 156 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 3 DVHGQLTVSNRNL-RLGSGKSRSRVHNFQFRIKDSNVEYFYPGSKT 137 DVHGQLTV N+ + G G SR+++ NFQFRIK++ ++YFYPG ++ Sbjct: 111 DVHGQLTVLNKGISNSGRGSSRNKLQNFQFRIKENGIDYFYPGCRS 156 >ref|XP_002872489.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318326|gb|EFH48748.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 262 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 3 DVHGQLTVSNRNL-RLGSGKSRSRVHNFQFRIKDSNVEYFYPGSKT 137 DVHGQLTV N+ + G G SR+++ NFQFRIK++ ++YFYPG ++ Sbjct: 217 DVHGQLTVLNKGISNSGRGTSRNKLQNFQFRIKENGIDYFYPGCRS 262