BLASTX nr result
ID: Salvia21_contig00004600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00004600 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 57 1e-06 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 452 MGTATFXXXXXXXXXXXLGVFLKFGCGAEFWICLILTLF 336 MGTATF LGVFLKFGCGAEFWICLILTLF Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLF 39