BLASTX nr result
ID: Salvia21_contig00003044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00003044 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC53941.1| H2A histone [Nicotiana tabacum] 128 4e-28 ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|... 127 7e-28 ref|XP_003558215.1| PREDICTED: histone H2A-like [Brachypodium di... 127 1e-27 sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Ful... 125 5e-27 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 125 5e-27 >dbj|BAC53941.1| H2A histone [Nicotiana tabacum] Length = 148 Score = 128 bits (322), Expect = 4e-28 Identities = 66/97 (68%), Positives = 75/97 (77%) Frame = +2 Query: 128 SIPKSVKAGLQFPVGRIARFLKKGRYAQRMGTGAPIYMXXXXXXXXXXXXXXXGNAARDN 307 S+ KSVKAGLQFPVGRIARFLKKGRYAQR+G+GAPIY+ GNAARDN Sbjct: 23 SVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN 82 Query: 308 KKSRIVPRHVQLAVRNDDELGKLVHGITIADCDRGGI 418 KKSRI+PRHV LAVRND+ELGKL+ G+TIA GG+ Sbjct: 83 KKSRIIPRHVLLAVRNDEELGKLLSGVTIAS---GGV 116 >ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|223548378|gb|EEF49869.1| histone h2a, putative [Ricinus communis] Length = 146 Score = 127 bits (320), Expect = 7e-28 Identities = 65/97 (67%), Positives = 74/97 (76%) Frame = +2 Query: 128 SIPKSVKAGLQFPVGRIARFLKKGRYAQRMGTGAPIYMXXXXXXXXXXXXXXXGNAARDN 307 S+ KSVKAGLQFPVGRIARFLKKGRYAQR G+GAP+Y+ GNAARDN Sbjct: 21 SVSKSVKAGLQFPVGRIARFLKKGRYAQRFGSGAPVYLAAVLEYLAAEVLELAGNAARDN 80 Query: 308 KKSRIVPRHVQLAVRNDDELGKLVHGITIADCDRGGI 418 KK+RI PRHV LAVRND+ELGKL+HG+TIA GG+ Sbjct: 81 KKNRINPRHVLLAVRNDEELGKLLHGVTIAS---GGV 114 >ref|XP_003558215.1| PREDICTED: histone H2A-like [Brachypodium distachyon] Length = 161 Score = 127 bits (318), Expect = 1e-27 Identities = 64/97 (65%), Positives = 74/97 (76%) Frame = +2 Query: 128 SIPKSVKAGLQFPVGRIARFLKKGRYAQRMGTGAPIYMXXXXXXXXXXXXXXXGNAARDN 307 S+ +SV+AGLQFPVGRI R+LKKGRYAQR+GTGAP+YM GNAARDN Sbjct: 27 SVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDN 86 Query: 308 KKSRIVPRHVQLAVRNDDELGKLVHGITIADCDRGGI 418 KKSRI+PRHV LAVRNDDELGKL+ G+TIA GG+ Sbjct: 87 KKSRIIPRHVLLAVRNDDELGKLLAGVTIA---HGGV 120 >sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 125 bits (313), Expect = 5e-27 Identities = 63/97 (64%), Positives = 74/97 (76%) Frame = +2 Query: 128 SIPKSVKAGLQFPVGRIARFLKKGRYAQRMGTGAPIYMXXXXXXXXXXXXXXXGNAARDN 307 S+ KS+KAGLQFPVGRI R+LKKGRYAQR+G+GAPIY+ GNAARDN Sbjct: 21 SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN 80 Query: 308 KKSRIVPRHVQLAVRNDDELGKLVHGITIADCDRGGI 418 KKSRI+PRHV LAVRND+ELGKL+ G+TIA GG+ Sbjct: 81 KKSRIIPRHVLLAVRNDEELGKLLAGVTIAS---GGV 114 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 125 bits (313), Expect = 5e-27 Identities = 63/97 (64%), Positives = 74/97 (76%) Frame = +2 Query: 128 SIPKSVKAGLQFPVGRIARFLKKGRYAQRMGTGAPIYMXXXXXXXXXXXXXXXGNAARDN 307 S+ KS+KAGLQFPVGRI R+LKKGRYAQR+G+GAPIY+ GNAARDN Sbjct: 21 SVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDN 80 Query: 308 KKSRIVPRHVQLAVRNDDELGKLVHGITIADCDRGGI 418 KKSRI+PRHV LAVRND+ELGKL+ G+TIA GG+ Sbjct: 81 KKSRIIPRHVLLAVRNDEELGKLLAGVTIAS---GGV 114