BLASTX nr result
ID: Salvia21_contig00001100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00001100 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517362.1| Potassium transporter, putative [Ricinus com... 61 1e-07 gb|ABI14646.1| putative high-affinity potassium transporter prot... 61 1e-07 gb|ABF85693.1| putative high-affinity potassium transporter 1 [N... 61 1e-07 gb|AAK53758.1|AF367864_1 putative potassium transporter HAK1p [M... 61 1e-07 ref|XP_004141081.1| PREDICTED: potassium transporter 8-like [Cuc... 60 1e-07 >ref|XP_002517362.1| Potassium transporter, putative [Ricinus communis] gi|223543373|gb|EEF44904.1| Potassium transporter, putative [Ricinus communis] Length = 767 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 116 DLSLKPSVDEIYGVLSFVFWTLTLIPLVKYVFIVLRAN 3 D+ + +EIYGVLSFVFWTLTLIPLVKYVFIVLRA+ Sbjct: 42 DIQHSETNEEIYGVLSFVFWTLTLIPLVKYVFIVLRAD 79 >gb|ABI14646.1| putative high-affinity potassium transporter protein 1 [Nicotiana tabacum] Length = 777 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 116 DLSLKPSVDEIYGVLSFVFWTLTLIPLVKYVFIVLRAN 3 D+ S DEI+GVLSFVFWTLTLIPL+KYVFIVLRA+ Sbjct: 58 DIQHSESDDEIFGVLSFVFWTLTLIPLLKYVFIVLRAD 95 >gb|ABF85693.1| putative high-affinity potassium transporter 1 [Nicotiana rustica] Length = 777 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 116 DLSLKPSVDEIYGVLSFVFWTLTLIPLVKYVFIVLRAN 3 D+ S DEI+GVLSFVFWTLTLIPL+KYVFIVLRA+ Sbjct: 58 DIQHSESNDEIFGVLSFVFWTLTLIPLLKYVFIVLRAD 95 >gb|AAK53758.1|AF367864_1 putative potassium transporter HAK1p [Mesembryanthemum crystallinum] Length = 772 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 116 DLSLKPSVDEIYGVLSFVFWTLTLIPLVKYVFIVLRAN 3 D+ S +EIYGVLSFVFWTLTLIPL+KYVFIVLRA+ Sbjct: 48 DIQHSESNEEIYGVLSFVFWTLTLIPLLKYVFIVLRAD 85 >ref|XP_004141081.1| PREDICTED: potassium transporter 8-like [Cucumis sativus] gi|449489448|ref|XP_004158314.1| PREDICTED: potassium transporter 8-like [Cucumis sativus] Length = 771 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 116 DLSLKPSVDEIYGVLSFVFWTLTLIPLVKYVFIVLRAN 3 D+ + +EIYGVLSFVFWTLTLIPL+KYVFIVLRA+ Sbjct: 50 DIKHSETNEEIYGVLSFVFWTLTLIPLIKYVFIVLRAD 87