BLASTX nr result
ID: Rheum21_contig00040660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00040660 (268 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826456.1| hypothetical protein AMTR_s00004p00208750, p... 57 2e-06 >ref|XP_006826456.1| hypothetical protein AMTR_s00004p00208750, partial [Amborella trichopoda] gi|548830770|gb|ERM93693.1| hypothetical protein AMTR_s00004p00208750, partial [Amborella trichopoda] Length = 70 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -2 Query: 261 LSDSALRSLYPLDYWDLTSQDSLYRTEGFEENEYPASRACFVWM 130 +SDSALRSLYPLDYWDLTSQDSLYR + + SRACF M Sbjct: 2 ISDSALRSLYPLDYWDLTSQDSLYRRR--QIHTPLISRACFARM 43