BLASTX nr result
ID: Rheum21_contig00040574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00040574 (276 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-29 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-29 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 132 4e-29 gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus pe... 132 4e-29 gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] 132 5e-29 ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Popu... 127 1e-27 gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial ... 126 3e-27 ref|XP_002282605.2| PREDICTED: pentatricopeptide repeat-containi... 126 3e-27 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 125 4e-27 ref|XP_003588753.1| Pentatricopeptide repeat-containing protein ... 124 1e-26 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 emb|CBI16436.3| unnamed protein product [Vitis vinifera] 122 5e-26 ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containi... 122 5e-26 emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] 122 5e-26 ref|XP_003628710.1| Pentatricopeptide repeat-containing protein ... 121 1e-25 ref|XP_004241773.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_006353692.1| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 132 bits (333), Expect = 4e-29 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LN+HSEKLA+AF LL+ PPG PIR+VKNLRVCNDCH+A K +SKIYNREIV+RDR RFHH Sbjct: 495 LNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 554 Query: 182 FKDGLCSCKDFW 217 FKDG CSC+DFW Sbjct: 555 FKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 132 bits (333), Expect = 4e-29 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LN+HSEKLA+AF LL+ PPG PIR+VKNLRVCNDCH+A K +SKIYNREIV+RDR RFHH Sbjct: 529 LNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 588 Query: 182 FKDGLCSCKDFW 217 FKDG CSC+DFW Sbjct: 589 FKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 132 bits (333), Expect = 4e-29 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LN+HSEKLA+AF LL+ PPG PIR+VKNLRVCNDCH+A K +SKIYNREIV+RDR RFHH Sbjct: 558 LNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHH 617 Query: 182 FKDGLCSCKDFW 217 FKDG CSC+DFW Sbjct: 618 FKDGSCSCRDFW 629 >gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 132 bits (333), Expect = 4e-29 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LNRHSEKLA+AF LL PPG PIR+VKNLRVC+DCH+A K +SKIYNREIV+RDR RFHH Sbjct: 413 LNRHSEKLAIAFALLNTPPGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHH 472 Query: 182 FKDGLCSCKDFW 217 FKDG+CSC+DFW Sbjct: 473 FKDGMCSCRDFW 484 >gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 132 bits (332), Expect = 5e-29 Identities = 58/72 (80%), Positives = 64/72 (88%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LNRHSEKLA+AF LL PPG PIR+VKNLRVC+DCH+A K +SKIYNREIV+RDR RFHH Sbjct: 528 LNRHSEKLAIAFALLNTPPGTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDRNRFHH 587 Query: 182 FKDGLCSCKDFW 217 F DGLCSCKDFW Sbjct: 588 FMDGLCSCKDFW 599 >ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] gi|449529652|ref|XP_004171812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 606 Score = 130 bits (328), Expect = 1e-28 Identities = 57/72 (79%), Positives = 64/72 (88%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LNRHSEKLA+AFGLLR PPG PIR+VKNLRVC+DCH+A K +SKIY+REI+MRDR RFHH Sbjct: 535 LNRHSEKLAIAFGLLRTPPGTPIRIVKNLRVCSDCHSASKFISKIYDREIIMRDRNRFHH 594 Query: 182 FKDGLCSCKDFW 217 FK G CSC DFW Sbjct: 595 FKSGQCSCGDFW 606 >ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 588 Score = 129 bits (325), Expect = 3e-28 Identities = 57/72 (79%), Positives = 63/72 (87%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LNRHSEKLA+AF LL PPG PIR+VKNLRVC DCH+A K +SKIYNREIV+RDR RFHH Sbjct: 517 LNRHSEKLAIAFALLNTPPGTPIRIVKNLRVCEDCHSATKFISKIYNREIVVRDRNRFHH 576 Query: 182 FKDGLCSCKDFW 217 FK+GLCSCK FW Sbjct: 577 FKNGLCSCKGFW 588 >ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] gi|550337158|gb|EEE92183.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] Length = 487 Score = 127 bits (320), Expect = 1e-27 Identities = 56/72 (77%), Positives = 64/72 (88%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LNRHSEKLA+AF LL PPG IR+VKNLRVC+DCH+A K +SKIYNREIV+RDR RFHH Sbjct: 416 LNRHSEKLAIAFALLNTPPGTLIRIVKNLRVCDDCHSASKFISKIYNREIVVRDRNRFHH 475 Query: 182 FKDGLCSCKDFW 217 FK+GLCSC+DFW Sbjct: 476 FKNGLCSCRDFW 487 >gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 126 bits (316), Expect = 3e-27 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L RHSEKLA+AFGLL PPG PIR+VKNLRVC DCH+A K +SK+Y+REIV+RDR RFHH Sbjct: 309 LYRHSEKLAIAFGLLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHH 368 Query: 182 FKDGLCSCKDFW 217 FK+GLCSC DFW Sbjct: 369 FKNGLCSCGDFW 380 >ref|XP_002282605.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] gi|296082021|emb|CBI21026.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 126 bits (316), Expect = 3e-27 Identities = 55/72 (76%), Positives = 61/72 (84%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L+RHSEKLA+AF LL PPG PIR+ KNLRVC DCH+A K +SKIYNREIVMRDR RFHH Sbjct: 512 LSRHSEKLAIAFALLNTPPGSPIRITKNLRVCGDCHSASKFISKIYNREIVMRDRSRFHH 571 Query: 182 FKDGLCSCKDFW 217 F+DG CSC DFW Sbjct: 572 FRDGQCSCGDFW 583 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] Length = 615 Score = 125 bits (315), Expect = 4e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L RHSEKLA+AF LL PPG PIR+VKNLRVC DCH+A K +SK+YNREIV+RDR RFHH Sbjct: 544 LYRHSEKLAIAFALLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHH 603 Query: 182 FKDGLCSCKDFW 217 FK+GLCSC DFW Sbjct: 604 FKNGLCSCGDFW 615 >ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477801|gb|AES59004.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 600 Score = 124 bits (312), Expect = 1e-26 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L RHSEKLA+AF LL PPG IR+VKNLRVC DCH+A K +SK+YNREIV+RDR RFHH Sbjct: 529 LYRHSEKLAIAFALLNTPPGTSIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHH 588 Query: 182 FKDGLCSCKDFW 217 FK+GLCSC+DFW Sbjct: 589 FKNGLCSCRDFW 600 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 124 bits (311), Expect = 1e-26 Identities = 53/72 (73%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L RHSEKLA+AF LL PPG IR+VKNLR+C DCH+A K +SK+YNREIV+RDR RFHH Sbjct: 538 LYRHSEKLAIAFALLNTPPGTSIRIVKNLRICEDCHSATKFISKVYNREIVVRDRNRFHH 597 Query: 182 FKDGLCSCKDFW 217 FK+GLCSC+DFW Sbjct: 598 FKNGLCSCRDFW 609 >emb|CBI16436.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 122 bits (306), Expect = 5e-26 Identities = 50/72 (69%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L++HSEKLA+AFGL+ PPG IR+VKNLRVC DCH A K +SK+Y REI++RDR+R+HH Sbjct: 474 LSKHSEKLAIAFGLINTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHH 533 Query: 182 FKDGLCSCKDFW 217 FKDG CSCKD+W Sbjct: 534 FKDGFCSCKDYW 545 >ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 624 Score = 122 bits (306), Expect = 5e-26 Identities = 50/72 (69%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L++HSEKLA+AFGL+ PPG IR+VKNLRVC DCH A K +SK+Y REI++RDR+R+HH Sbjct: 553 LSKHSEKLAIAFGLINTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHH 612 Query: 182 FKDGLCSCKDFW 217 FKDG CSCKD+W Sbjct: 613 FKDGFCSCKDYW 624 >emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] Length = 539 Score = 122 bits (306), Expect = 5e-26 Identities = 50/72 (69%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 L++HSEKLA+AFGL+ PPG IR+VKNLRVC DCH A K +SK+Y REI++RDR+R+HH Sbjct: 468 LSKHSEKLAIAFGLINTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHH 527 Query: 182 FKDGLCSCKDFW 217 FKDG CSCKD+W Sbjct: 528 FKDGFCSCKDYW 539 >ref|XP_003628710.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522732|gb|AET03186.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 748 Score = 121 bits (303), Expect = 1e-25 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LN HSEKLA+AFGLL +PPGLPIR+VKNLRVC+DCH A K++SKI NREI++RD RFH Sbjct: 677 LNHHSEKLAIAFGLLFIPPGLPIRVVKNLRVCSDCHNATKYISKITNREILVRDTARFHL 736 Query: 182 FKDGLCSCKDFW 217 FKDG CSC DFW Sbjct: 737 FKDGTCSCGDFW 748 >ref|XP_004241773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 607 Score = 120 bits (302), Expect = 1e-25 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 +NRHSEKLA+AF L++ PPG PIR+VKNLRVC DCH+A K +SK Y REI++RDR RFH Sbjct: 536 VNRHSEKLAIAFALMKTPPGTPIRIVKNLRVCEDCHSATKFISKTYKREILVRDRNRFHR 595 Query: 182 FKDGLCSCKDFW 217 F DG+CSCKDFW Sbjct: 596 FVDGVCSCKDFW 607 >ref|XP_006353692.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 605 Score = 120 bits (301), Expect = 2e-25 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 +NRHSEKLA+AF L++ PPG PIR+VKNLRVC DCH+A K +SK Y REI++RDR RFH Sbjct: 534 VNRHSEKLAIAFALMKTPPGTPIRIVKNLRVCEDCHSATKFISKTYKREILVRDRNRFHR 593 Query: 182 FKDGLCSCKDFW 217 F DG+CSCKDFW Sbjct: 594 FIDGVCSCKDFW 605 >ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum lycopersicum] Length = 1224 Score = 120 bits (301), Expect = 2e-25 Identities = 50/72 (69%), Positives = 64/72 (88%) Frame = +2 Query: 2 LNRHSEKLAVAFGLLRVPPGLPIRLVKNLRVCNDCHAAMKHVSKIYNREIVMRDRMRFHH 181 LN HSEKLAVA+GLL++P G+PIR++KNLRVC DCH+A+K ++K+ REI++RD RFHH Sbjct: 1153 LNYHSEKLAVAYGLLKLPQGMPIRIMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHH 1212 Query: 182 FKDGLCSCKDFW 217 FKDG+CSCKDFW Sbjct: 1213 FKDGVCSCKDFW 1224