BLASTX nr result
ID: Rheum21_contig00040298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00040298 (331 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385578.1| hypothetical protein POPTR_0003s08270g [Popu... 57 3e-06 ref|XP_002329596.1| predicted protein [Populus trichocarpa] 57 3e-06 ref|XP_002533788.1| pentatricopeptide repeat-containing protein,... 55 7e-06 >ref|XP_006385578.1| hypothetical protein POPTR_0003s08270g [Populus trichocarpa] gi|550342705|gb|ERP63375.1| hypothetical protein POPTR_0003s08270g [Populus trichocarpa] Length = 701 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 3/98 (3%) Frame = +1 Query: 43 SALQKQALRLIANGNFVCGSCLTADLCNWRSEFRNSYQRHLSITTQSRHGEV---GSSRE 213 SA+QK AL +G F +++ +H S + S+ G + GSS Sbjct: 21 SAIQKTALIADHSGEFFSKRVF--------GQYQLVALQHFSSGSVSQPGRICWRGSSNV 72 Query: 214 ILLKTIGISLKEHRIEEAWKAFTDFKCLYGFPVASTLS 327 +LL+ + I+L+EH+++EAW F DFK LYGFP S ++ Sbjct: 73 VLLRKLEIALREHQVDEAWVTFIDFKKLYGFPTGSMVN 110 >ref|XP_002329596.1| predicted protein [Populus trichocarpa] Length = 701 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 3/98 (3%) Frame = +1 Query: 43 SALQKQALRLIANGNFVCGSCLTADLCNWRSEFRNSYQRHLSITTQSRHGEV---GSSRE 213 SA+QK AL +G F +++ +H S + S+ G + GSS Sbjct: 21 SAIQKTALIADHSGEFFSKRVF--------GQYQLVALQHFSSGSVSQPGRICWRGSSNV 72 Query: 214 ILLKTIGISLKEHRIEEAWKAFTDFKCLYGFPVASTLS 327 +LL+ + I+L+EH+++EAW F DFK LYGFP S ++ Sbjct: 73 VLLRKLEIALREHQVDEAWVTFIDFKKLYGFPTGSMVN 110 >ref|XP_002533788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526289|gb|EEF28601.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 689 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/63 (47%), Positives = 37/63 (58%) Frame = +1 Query: 121 CNWRSEFRNSYQRHLSITTQSRHGEVGSSREILLKTIGISLKEHRIEEAWKAFTDFKCLY 300 C W F NS Q + T R GSS +LL+ + +SLK+HR+ EAW F DFK LY Sbjct: 34 CKWH-HFGNS-QPFSTRTQPERLCWEGSSHGVLLRKLEVSLKDHRLNEAWVTFNDFKTLY 91 Query: 301 GFP 309 GFP Sbjct: 92 GFP 94