BLASTX nr result
ID: Rheum21_contig00039854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00039854 (333 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containi... 75 9e-12 emb|CBI26355.3| unnamed protein product [Vitis vinifera] 75 9e-12 ref|XP_006350660.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 gb|EOY05877.1| Tetratricopeptide repeat-like superfamily protein... 72 8e-11 ref|XP_004241033.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_002517025.1| pentatricopeptide repeat-containing protein,... 69 5e-10 >ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 642 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = +2 Query: 164 LQLLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFDGI 331 L ++++C+T+ LKS+HARLLIE S ASS+ + NKL+RLYSRFG YAHKVFD I Sbjct: 6 LHIIHNCKTLKSLKSIHARLLIESSVASSEFVINKLLRLYSRFGATDYAHKVFDEI 61 >emb|CBI26355.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/56 (62%), Positives = 45/56 (80%) Frame = +2 Query: 164 LQLLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFDGI 331 L ++++C+T+ LKS+HARLLIE S ASS+ + NKL+RLYSRFG YAHKVFD I Sbjct: 6 LHIIHNCKTLKSLKSIHARLLIESSVASSEFVINKLLRLYSRFGATDYAHKVFDEI 61 >ref|XP_006350660.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 668 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +2 Query: 170 LLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFDGI 331 LL +C+T+ LKSVHA LL+ GS ASSDL+ NK+IRLYSRFG +YA KVFD I Sbjct: 8 LLQTCKTLHRLKSVHAHLLVCGSIASSDLVLNKIIRLYSRFGATNYARKVFDEI 61 >gb|EOY05877.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713981|gb|EOY05878.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 683 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = +2 Query: 164 LQLLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFDGI 331 L LL+ Q++ LKS+HARLLI+GS ASSDL+ NK +R Y+RFG + YAHK+FD I Sbjct: 22 LSLLDRAQSLKPLKSIHARLLIDGSIASSDLVLNKFLRFYARFGSIQYAHKLFDQI 77 >ref|XP_004241033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] Length = 668 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = +2 Query: 167 QLLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFDGI 331 +LL +C+T+ LKSVHA LL+ GS ASSDL+ NK+IRLY+RFG +YA KVFD I Sbjct: 7 RLLQTCKTLHSLKSVHAHLLVCGSIASSDLVLNKIIRLYTRFGATNYARKVFDEI 61 >ref|XP_002517025.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543660|gb|EEF45188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 640 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 167 QLLNSCQTVIHLKSVHARLLIEGSYASSDLIHNKLIRLYSRFGFVSYAHKVFD 325 +LL C+++ L ++HA LLI GS ASSDL NKL+RLYS+FG VSYAHK+FD Sbjct: 8 KLLKQCRSLKTLTTIHAHLLISGSIASSDLTLNKLLRLYSKFGAVSYAHKLFD 60