BLASTX nr result
ID: Rheum21_contig00038331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00038331 (238 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16193.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002284421.1| PREDICTED: uncharacterized protein LOC100244... 59 9e-07 emb|CAN80354.1| hypothetical protein VITISV_003142 [Vitis vinifera] 59 9e-07 >emb|CBI16193.3| unnamed protein product [Vitis vinifera] Length = 349 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +2 Query: 71 QRVEFLKQRILTMTYELELVQFQKEEEMRKRRESVKDMKQLLQLLQVAFKERDEAR 238 + +E LKQ++L T ELE + + EEM+K +ES+ KQLLQLL+VA++ERDEAR Sbjct: 12 ENIEELKQKLLYATIELESARMEANEEMKKNKESI---KQLLQLLKVAYQERDEAR 64 >ref|XP_002284421.1| PREDICTED: uncharacterized protein LOC100244942 [Vitis vinifera] Length = 317 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +2 Query: 71 QRVEFLKQRILTMTYELELVQFQKEEEMRKRRESVKDMKQLLQLLQVAFKERDEAR 238 + +E LKQ++L T ELE + + EEM+K +ES+ KQLLQLL+VA++ERDEAR Sbjct: 12 ENIEELKQKLLYATIELESARMEANEEMKKNKESI---KQLLQLLKVAYQERDEAR 64 >emb|CAN80354.1| hypothetical protein VITISV_003142 [Vitis vinifera] Length = 347 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +2 Query: 71 QRVEFLKQRILTMTYELELVQFQKEEEMRKRRESVKDMKQLLQLLQVAFKERDEAR 238 + +E LKQ++L T ELE + + EEM+K +ES+ KQLLQLL+VA++ERDEAR Sbjct: 42 ENIEELKQKLLYATIELESARMEANEEMKKNKESI---KQLLQLLKVAYQERDEAR 94