BLASTX nr result
ID: Rheum21_contig00038272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00038272 (367 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA69646.1| ethylene response sensor protein [Rumex palustri... 65 9e-09 >emb|CAA69646.1| ethylene response sensor protein [Rumex palustris] gi|2353690|gb|AAB68819.1| ethylene receptor [Rumex palustris] Length = 628 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 367 SIHQVASTGHMNQRSTDLLGDSSMSFSFKRFEKSC 263 SI+Q ASTGHMNQ STDLLGDSSMSFS KRFEKSC Sbjct: 594 SINQAASTGHMNQSSTDLLGDSSMSFSLKRFEKSC 628