BLASTX nr result
ID: Rheum21_contig00037992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037992 (328 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368473.1| hypothetical protein POPTR_0001s03120g [Popu... 59 7e-07 ref|XP_002326493.1| predicted protein [Populus trichocarpa] 59 9e-07 ref|XP_006436835.1| hypothetical protein CICLE_v10033731mg [Citr... 55 7e-06 >ref|XP_006368473.1| hypothetical protein POPTR_0001s03120g [Populus trichocarpa] gi|550346387|gb|ERP65042.1| hypothetical protein POPTR_0001s03120g [Populus trichocarpa] Length = 261 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -3 Query: 326 LKGVCGAETRVWAASEVRASTAECLDELASHGFGVSELMSQTRPRGGSGSEVFAVYKLVP 147 LK V G +TRV AASEVR T ECL+EL S GF V E+ Q G G ++FAVY ++P Sbjct: 186 LKKVSGNKTRVLAASEVRFWTGECLNELVSQGFKVVEVPIQEDGSDG-GRDIFAVYNIIP 244 Query: 146 P 144 P Sbjct: 245 P 245 >ref|XP_002326493.1| predicted protein [Populus trichocarpa] Length = 261 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -3 Query: 326 LKGVCGAETRVWAASEVRASTAECLDELASHGFGVSELMSQTRPRGGSGSEVFAVYKLVP 147 LK V G +TR+ AASEVR T ECL+EL S GF V E+ Q G G ++FAVY ++P Sbjct: 186 LKKVSGNKTRILAASEVRFWTGECLNELVSQGFKVVEVPIQEDGSDG-GRDIFAVYNIIP 244 Query: 146 P 144 P Sbjct: 245 P 245 >ref|XP_006436835.1| hypothetical protein CICLE_v10033731mg [Citrus clementina] gi|557539031|gb|ESR50075.1| hypothetical protein CICLE_v10033731mg [Citrus clementina] Length = 218 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/64 (54%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = -3 Query: 326 LKGVCGA--ETRVWAASEVRASTAECLDEL-ASHGFGVSELMSQTRPRGGSGSEVFAVYK 156 LK VCG T VWA SEVR T +CL EL S GF V EL Q GG E FAVY+ Sbjct: 147 LKRVCGTGRHTVVWAVSEVRTRTGDCLHELIMSQGFRVIELTCQL---GGGCPEAFAVYE 203 Query: 155 LVPP 144 L PP Sbjct: 204 LTPP 207