BLASTX nr result
ID: Rheum21_contig00037921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037921 (300 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002334234.1| predicted protein [Populus trichocarpa] 63 5e-08 ref|XP_006380206.1| hypothetical protein POPTR_0008s22930g [Popu... 62 6e-08 ref|XP_004150082.1| PREDICTED: importin subunit alpha-1-like [Cu... 59 7e-07 ref|XP_006378029.1| hypothetical protein POPTR_0010s00370g, part... 59 9e-07 ref|XP_006842676.1| hypothetical protein AMTR_s00147p00043750 [A... 59 9e-07 gb|EOY06649.1| Importin subunit alpha-1a isoform 3 [Theobroma ca... 59 9e-07 gb|EOY06648.1| Importin alpha isoform 2 [Theobroma cacao] 59 9e-07 gb|EOY06647.1| Importin alpha isoform 1 [Theobroma cacao] 59 9e-07 ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Ci... 59 9e-07 gb|AFW81447.1| hypothetical protein ZEAMMB73_731576 [Zea mays] g... 59 9e-07 ref|XP_003633608.1| PREDICTED: importin subunit alpha-1 isoform ... 59 9e-07 ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Gl... 59 9e-07 ref|XP_002315463.1| predicted protein [Populus trichocarpa] 59 9e-07 ref|XP_002328576.1| predicted protein [Populus trichocarpa] gi|5... 59 9e-07 ref|XP_001763761.1| predicted protein [Physcomitrella patens] gi... 59 9e-07 ref|XP_001773628.1| predicted protein [Physcomitrella patens] gi... 59 9e-07 ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 [Vitis v... 59 9e-07 ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 isoform ... 59 9e-07 gb|ABM05488.1| Impa2 [Nicotiana benthamiana] 59 9e-07 gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum] 59 9e-07 >ref|XP_002334234.1| predicted protein [Populus trichocarpa] Length = 383 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLIRMKREFIISFI 122 NHKKSIKKEACWTISNI+AGNKEQIQV + ++SF+ Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQVSMHALEAHVLSFV 378 >ref|XP_006380206.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa] gi|550333727|gb|ERP58003.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa] Length = 383 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLIRMKREFIISFI 122 NHKKSIKKEACWTISNI+AGNKEQIQV + ++SF+ Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQVSMHALEVHVLSFV 378 >ref|XP_004150082.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] gi|449501502|ref|XP_004161385.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] Length = 530 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLIRMK 98 NHKKSIKKEACWTISNI+AGNKEQIQ +I + Sbjct: 338 NHKKSIKKEACWTISNITAGNKEQIQAVIEAR 369 >ref|XP_006378029.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa] gi|550328792|gb|ERP55826.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa] Length = 285 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 42 NHKKSIKKEACWTISNITAGNKEQIQAVI 70 >ref|XP_006842676.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda] gi|548844777|gb|ERN04351.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda] Length = 527 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 337 NHKKSIKKEACWTISNITAGNKEQIQAVI 365 >gb|EOY06649.1| Importin subunit alpha-1a isoform 3 [Theobroma cacao] Length = 416 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 338 NHKKSIKKEACWTISNITAGNKEQIQAVI 366 >gb|EOY06648.1| Importin alpha isoform 2 [Theobroma cacao] Length = 532 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >gb|EOY06647.1| Importin alpha isoform 1 [Theobroma cacao] Length = 531 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 338 NHKKSIKKEACWTISNITAGNKEQIQAVI 366 >ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum] Length = 531 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 340 NHKKSIKKEACWTISNITAGNKEQIQAVI 368 >gb|AFW81447.1| hypothetical protein ZEAMMB73_731576 [Zea mays] gi|413948799|gb|AFW81448.1| hypothetical protein ZEAMMB73_731576 [Zea mays] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 340 NHKKSIKKEACWTISNITAGNKEQIQAVI 368 >ref|XP_003633608.1| PREDICTED: importin subunit alpha-1 isoform 2 [Vitis vinifera] Length = 528 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 530 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQTVI 367 >ref|XP_002315463.1| predicted protein [Populus trichocarpa] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >ref|XP_002328576.1| predicted protein [Populus trichocarpa] gi|566185456|ref|XP_006380207.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa] gi|550333728|gb|ERP58004.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >ref|XP_001763761.1| predicted protein [Physcomitrella patens] gi|162685005|gb|EDQ71403.1| predicted protein [Physcomitrella patens] Length = 531 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >ref|XP_001773628.1| predicted protein [Physcomitrella patens] gi|162675016|gb|EDQ61516.1| predicted protein [Physcomitrella patens] Length = 531 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 339 NHKKSIKKEACWTISNITAGNKEQIQAVI 367 >ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera] gi|296083287|emb|CBI22923.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 338 NHKKSIKKEACWTISNITAGNKEQIQAVI 366 >ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 isoform 1 [Vitis vinifera] gi|296089748|emb|CBI39567.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 338 NHKKSIKKEACWTISNITAGNKEQIQAVI 366 >gb|ABM05488.1| Impa2 [Nicotiana benthamiana] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 340 NHKKSIKKEACWTISNITAGNKEQIQAVI 368 >gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum] Length = 529 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 NHKKSIKKEACWTISNISAGNKEQIQVLI 89 NHKKSIKKEACWTISNI+AGNKEQIQ +I Sbjct: 340 NHKKSIKKEACWTISNITAGNKEQIQAVI 368