BLASTX nr result
ID: Rheum21_contig00037828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037828 (262 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141874.1| PREDICTED: UPF0553 protein-like [Cucumis sat... 80 2e-13 ref|XP_006426072.1| hypothetical protein CICLE_v10025991mg [Citr... 79 5e-13 ref|XP_006339813.1| PREDICTED: UPF0553 protein-like [Solanum tub... 79 6e-13 gb|EMJ06823.1| hypothetical protein PRUPE_ppa009128mg [Prunus pe... 79 8e-13 ref|XP_006466479.1| PREDICTED: UPF0553 protein-like [Citrus sine... 78 1e-12 ref|XP_002304318.1| predicted protein [Populus trichocarpa] gi|5... 78 1e-12 ref|XP_004231913.1| PREDICTED: UPF0553 protein-like [Solanum lyc... 77 2e-12 ref|XP_004288236.1| PREDICTED: UPF0553 protein-like [Fragaria ve... 76 4e-12 gb|EPS61718.1| hypothetical protein M569_13076 [Genlisea aurea] 75 7e-12 gb|ABR17655.1| unknown [Picea sitchensis] 75 7e-12 gb|EXB40444.1| hypothetical protein L484_013747 [Morus notabilis] 75 9e-12 gb|EOX91648.1| Uncharacterized protein TCM_000771 [Theobroma cacao] 74 2e-11 ref|XP_004511854.1| PREDICTED: UPF0553 protein-like isoform X2 [... 74 2e-11 ref|XP_004511853.1| PREDICTED: UPF0553 protein-like isoform X1 [... 74 2e-11 ref|XP_006590325.1| PREDICTED: uncharacterized protein LOC100802... 74 2e-11 ref|XP_003517340.1| PREDICTED: UPF0553 protein-like isoform X1 [... 74 2e-11 gb|ESW28721.1| hypothetical protein PHAVU_002G012100g [Phaseolus... 74 2e-11 emb|CBI33705.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002284329.1| PREDICTED: UPF0553 protein [Vitis vinifera] ... 74 2e-11 ref|NP_001242636.1| uncharacterized protein LOC100802234 [Glycin... 71 1e-10 >ref|XP_004141874.1| PREDICTED: UPF0553 protein-like [Cucumis sativus] gi|449519100|ref|XP_004166573.1| PREDICTED: UPF0553 protein-like [Cucumis sativus] Length = 94 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+GKQVLSVELDLWLWS+G++ PSL HHRTLSIYY Sbjct: 51 EKMRELISMKSGKQVLSVELDLWLWSFGIQCPSLTHHRTLSIYY 94 >ref|XP_006426072.1| hypothetical protein CICLE_v10025991mg [Citrus clementina] gi|557528062|gb|ESR39312.1| hypothetical protein CICLE_v10025991mg [Citrus clementina] Length = 344 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+GKQVLSVELDLWLWS GV+ P+L+HHRTLSIYY Sbjct: 301 EKMRELIRIKSGKQVLSVELDLWLWSVGVQCPALQHHRTLSIYY 344 >ref|XP_006339813.1| PREDICTED: UPF0553 protein-like [Solanum tuberosum] Length = 306 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKM++LI KTGKQVLSVELDLWLW++G++ PSL+HHRTLSIYY Sbjct: 263 EKMKELISKKTGKQVLSVELDLWLWAFGIQCPSLQHHRTLSIYY 306 >gb|EMJ06823.1| hypothetical protein PRUPE_ppa009128mg [Prunus persica] Length = 305 Score = 78.6 bits (192), Expect = 8e-13 Identities = 32/44 (72%), Positives = 42/44 (95%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKM++LI +K+GKQVLS+ELDLWLWS+G++ P+L+HHRTLSIYY Sbjct: 262 EKMKELISMKSGKQVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_006466479.1| PREDICTED: UPF0553 protein-like [Citrus sinensis] Length = 306 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKM++LI +K+GKQVLSVELDLWLWS GV+ P+L+HHRTLSIYY Sbjct: 263 EKMKELIRIKSGKQVLSVELDLWLWSVGVQCPALQHHRTLSIYY 306 >ref|XP_002304318.1| predicted protein [Populus trichocarpa] gi|566180473|ref|XP_006380628.1| hypothetical protein POPTR_0007s09960g [Populus trichocarpa] gi|550334518|gb|ERP58425.1| hypothetical protein POPTR_0007s09960g [Populus trichocarpa] Length = 306 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMRDLI +K GKQVLSVELDLWLW+YGV+ PSL +HRTLSIYY Sbjct: 263 EKMRDLISVKLGKQVLSVELDLWLWAYGVQNPSLPYHRTLSIYY 306 >ref|XP_004231913.1| PREDICTED: UPF0553 protein-like [Solanum lycopersicum] Length = 306 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EK+++LI KTGKQVLSVELDLWLW++G++ PSL+HHRTLSIYY Sbjct: 263 EKIKELISKKTGKQVLSVELDLWLWAFGIQCPSLQHHRTLSIYY 306 >ref|XP_004288236.1| PREDICTED: UPF0553 protein-like [Fragaria vesca subsp. vesca] Length = 305 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKM+DLI +K G++VLS+ELDLWLWS+G++ P+L+HHRTLSIYY Sbjct: 262 EKMKDLISIKLGRKVLSIELDLWLWSFGIQIPALQHHRTLSIYY 305 >gb|EPS61718.1| hypothetical protein M569_13076 [Genlisea aurea] Length = 306 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 E++RD I K+GKQ LSVELDLWLW+YGVK PSL+HHRTLS+YY Sbjct: 263 EEIRDSIRKKSGKQYLSVELDLWLWAYGVKCPSLQHHRTLSMYY 306 >gb|ABR17655.1| unknown [Picea sitchensis] Length = 306 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EK+R+LI K GK+VLS++LDLWLWS GVK PSL+HHRTLSIYY Sbjct: 263 EKLRELIGTKAGKEVLSIQLDLWLWSCGVKCPSLQHHRTLSIYY 306 >gb|EXB40444.1| hypothetical protein L484_013747 [Morus notabilis] Length = 371 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI+ K+GKQVL VELD WLW++G++ PSL+HHRTLS+YY Sbjct: 328 EKMRELINTKSGKQVLGVELDHWLWTFGIQLPSLKHHRTLSVYY 371 >gb|EOX91648.1| Uncharacterized protein TCM_000771 [Theobroma cacao] Length = 306 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EK+R+L+ K+GKQVLSVELDLWLWS GVK SL+HHRTLSIYY Sbjct: 263 EKIRELLSKKSGKQVLSVELDLWLWSVGVKRQSLQHHRTLSIYY 306 >ref|XP_004511854.1| PREDICTED: UPF0553 protein-like isoform X2 [Cicer arietinum] Length = 349 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV+ SL+HHRTLSIYY Sbjct: 306 EKMRELISVKSGRQVLSVELDLWLWASGVQCESLKHHRTLSIYY 349 >ref|XP_004511853.1| PREDICTED: UPF0553 protein-like isoform X1 [Cicer arietinum] Length = 353 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV+ SL+HHRTLSIYY Sbjct: 310 EKMRELISVKSGRQVLSVELDLWLWASGVQCESLKHHRTLSIYY 353 >ref|XP_006590325.1| PREDICTED: uncharacterized protein LOC100802234 isoform X1 [Glycine max] gi|571486410|ref|XP_006590326.1| PREDICTED: uncharacterized protein LOC100802234 isoform X2 [Glycine max] Length = 305 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV++ SL+HHRTLSIYY Sbjct: 262 EKMRELISVKSGRQVLSVELDLWLWASGVQSTSLQHHRTLSIYY 305 >ref|XP_003517340.1| PREDICTED: UPF0553 protein-like isoform X1 [Glycine max] gi|571436068|ref|XP_006573656.1| PREDICTED: UPF0553 protein-like isoform X2 [Glycine max] gi|571436071|ref|XP_006573657.1| PREDICTED: UPF0553 protein-like isoform X3 [Glycine max] Length = 305 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV++ SL+HHRTLSIYY Sbjct: 262 EKMRELISVKSGRQVLSVELDLWLWASGVQSASLQHHRTLSIYY 305 >gb|ESW28721.1| hypothetical protein PHAVU_002G012100g [Phaseolus vulgaris] Length = 305 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV+ SL+HHRTLSIYY Sbjct: 262 EKMRELISVKSGRQVLSVELDLWLWAAGVQCTSLQHHRTLSIYY 305 >emb|CBI33705.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+L+ K+G QVLSVELDLWLWS+G++ SL+HHRTLSIYY Sbjct: 263 EKMRELLSKKSGNQVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 306 >ref|XP_002284329.1| PREDICTED: UPF0553 protein [Vitis vinifera] gi|147768860|emb|CAN78136.1| hypothetical protein VITISV_034055 [Vitis vinifera] Length = 309 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+L+ K+G QVLSVELDLWLWS+G++ SL+HHRTLSIYY Sbjct: 266 EKMRELLSKKSGNQVLSVELDLWLWSFGIQCQSLQHHRTLSIYY 309 >ref|NP_001242636.1| uncharacterized protein LOC100802234 [Glycine max] gi|255646574|gb|ACU23761.1| unknown [Glycine max] Length = 305 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -1 Query: 262 EKMRDLIHLKTGKQVLSVELDLWLWSYGVKAPSLRHHRTLSIYY 131 EKMR+LI +K+G+QVLSVELDLWLW+ GV++ SL+H RTLSIYY Sbjct: 262 EKMRELISVKSGRQVLSVELDLWLWASGVQSTSLQHRRTLSIYY 305