BLASTX nr result
ID: Rheum21_contig00037703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037703 (357 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB51896.1| hypothetical protein L484_006241 [Morus notabilis] 59 5e-07 ref|XP_006376993.1| hypothetical protein POPTR_0012s11890g [Popu... 56 4e-06 ref|XP_002332130.1| predicted protein [Populus trichocarpa] 56 4e-06 ref|XP_002336351.1| predicted protein [Populus trichocarpa] 56 4e-06 gb|EOY27493.1| Mitochondrial transcription termination factor fa... 56 6e-06 >gb|EXB51896.1| hypothetical protein L484_006241 [Morus notabilis] Length = 564 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 357 LGTILACSESRFMKYFVEVHPEGRGFWETLKQSAAS 250 L T+LACS+SRF+KYFV+VHPEG WETLK S+ S Sbjct: 528 LSTLLACSDSRFLKYFVDVHPEGPAMWETLKSSSVS 563 >ref|XP_006376993.1| hypothetical protein POPTR_0012s11890g [Populus trichocarpa] gi|550326928|gb|ERP54790.1| hypothetical protein POPTR_0012s11890g [Populus trichocarpa] Length = 523 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 357 LGTILACSESRFMKYFVEVHPEGRGFWETLKQSAAS 250 L TILACS++RF+KYFV+VHPEG WE+L+ ++AS Sbjct: 487 LSTILACSDARFIKYFVDVHPEGPAMWESLRNTSAS 522 >ref|XP_002332130.1| predicted protein [Populus trichocarpa] Length = 577 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 357 LGTILACSESRFMKYFVEVHPEGRGFWETLKQSAAS 250 L TILACS++RF+KYFV+VHPEG WE+L+ ++AS Sbjct: 541 LSTILACSDARFIKYFVDVHPEGPAMWESLRNTSAS 576 >ref|XP_002336351.1| predicted protein [Populus trichocarpa] Length = 139 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 357 LGTILACSESRFMKYFVEVHPEGRGFWETLKQSAAS 250 L TILACS++RF+KYFV+VHPEG WE+L+ ++AS Sbjct: 103 LSTILACSDARFIKYFVDVHPEGPAMWESLRNTSAS 138 >gb|EOY27493.1| Mitochondrial transcription termination factor family protein, putative [Theobroma cacao] Length = 593 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 357 LGTILACSESRFMKYFVEVHPEGRGFWETLKQSAAS 250 L T+LACS++RF+KYFV+VHPEG WETLK+S S Sbjct: 557 LSTVLACSDARFVKYFVDVHPEGPAKWETLKKSLHS 592