BLASTX nr result
ID: Rheum21_contig00037689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037689 (310 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 64 3e-08 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|355477312|gb|AES58515.1| hypothetical protein MTR_1g005050 [Medicago truncatula] Length = 334 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 305 LCLSCSHARRAEDLSCPGLGKYVEIFVGPWRESQ 204 L LSCSHARR EDLSCPGL KYVEIFVGP RESQ Sbjct: 153 LYLSCSHARRPEDLSCPGLDKYVEIFVGPGRESQ 186