BLASTX nr result
ID: Rheum21_contig00037685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037685 (350 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37171.1| hypothetical protein L484_013535 [Morus notabilis] 55 7e-06 >gb|EXB37171.1| hypothetical protein L484_013535 [Morus notabilis] Length = 59 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/41 (53%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = -1 Query: 224 CMFFS-NHSDIGCCTQVIIGYWIGPDPEDGWGFVEAFLNEI 105 C+F+ N D G +I GYW+GPD +DGWGF+EAF+N I Sbjct: 18 CLFYDVNGYDAGSSHMIISGYWVGPDVDDGWGFIEAFINPI 58