BLASTX nr result
ID: Rheum21_contig00037526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037526 (350 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medi... 74 3e-11 >ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] gi|355486258|gb|AES67461.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 335 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -2 Query: 187 SPV*TCLSNEDLPTYCKVRLCPFPRIHSGSEEQLV*LLEQPRY 59 +PV T SNEDLPTYCKVRLCP PRIHSGSEE LV LLEQPRY Sbjct: 293 TPVLTRPSNEDLPTYCKVRLCPSPRIHSGSEELLVQLLEQPRY 335