BLASTX nr result
ID: Rheum21_contig00037476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037476 (278 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ14821.1| hypothetical protein PRUPE_ppa002146mg [Prunus pe... 60 2e-07 ref|XP_006394244.1| hypothetical protein EUTSA_v10003726mg [Eutr... 56 4e-06 >gb|EMJ14821.1| hypothetical protein PRUPE_ppa002146mg [Prunus persica] Length = 709 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +1 Query: 88 MVGLGVFNLSRLPALLNACSPILLRWLLPGSFFLLAVIYTLAKWQKKTSLNWV 246 MV LG+ +L+R+ L+ P LL WL+ GSF LLA+I+ KWQK+TSLNWV Sbjct: 2 MVDLGI-SLARVATSLDGYGPFLLGWLVTGSFGLLAIIFAFLKWQKRTSLNWV 53 >ref|XP_006394244.1| hypothetical protein EUTSA_v10003726mg [Eutrema salsugineum] gi|557090883|gb|ESQ31530.1| hypothetical protein EUTSA_v10003726mg [Eutrema salsugineum] Length = 711 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 139 ACSPILLRWLLPGSFFLLAVIYTLAKWQKKTSLNWV 246 A SP + WL+ GSF +LAV+YT+ KWQKKTSLNWV Sbjct: 17 ADSPFIFGWLVTGSFGVLAVVYTILKWQKKTSLNWV 52