BLASTX nr result
ID: Rheum21_contig00037474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037474 (335 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 41 9e-08 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 40.8 bits (94), Expect(3) = 9e-08 Identities = 16/37 (43%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 81 THVY-LTRKTYALKVNAKHWNKTTFGNIFKQHKEVED 188 +H++ +K +K+N+K WNKT FGNIF+Q ++V++ Sbjct: 274 SHMFNFVQKCKLVKINSKEWNKTQFGNIFRQLRQVDE 310 Score = 33.5 bits (75), Expect(3) = 9e-08 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 1 KFEKMWTYKKYFENIVKQALRINTQGSHMFILQEK 105 +FEKMW +K ++++VK+ GSHMF +K Sbjct: 248 RFEKMWCTRKDYDSLVKRTWCTKFYGSHMFNFVQK 282 Score = 26.6 bits (57), Expect(3) = 9e-08 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 242 SNKQINLQKRKKLLSFHKFFWSQRAKT 322 + +++ L KR KLL ++ +W Q+ K+ Sbjct: 330 TQQELFLAKRNKLLEYNTTYWKQKCKS 356