BLASTX nr result
ID: Rheum21_contig00037307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037307 (306 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 65 3e-14 gb|EMJ25387.1| hypothetical protein PRUPE_ppa016658mg, partial [... 42 1e-06 gb|EOY08210.1| Uncharacterized protein TCM_022554 [Theobroma cacao] 39 1e-05 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 64.7 bits (156), Expect(2) = 3e-14 Identities = 29/59 (49%), Positives = 38/59 (64%) Frame = -1 Query: 300 ISGARVDEVCR*IDFNGILRVDADGFFGGIWLIWRTSEVVVHPISLHPQHITVKISLFG 124 ISG + +C I F+G RV+A+GF GGIWL W++ EV V P H QH+TV+I G Sbjct: 39 ISGDQAQRICDRIGFSGQTRVEAEGFRGGIWLFWKSEEVTVTPYGSHSQHLTVEIRRIG 97 Score = 38.9 bits (89), Expect(2) = 3e-14 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = -2 Query: 128 LGEEHWILSAIYASPNPSSRVALSDQLVDFARINNRPWLLAG 3 +G++ W+ SAIYASP+ + R L +L PWLLAG Sbjct: 96 IGDDPWLFSAIYASPDSTLRKELWRELEQIKNQYTGPWLLAG 137 >gb|EMJ25387.1| hypothetical protein PRUPE_ppa016658mg, partial [Prunus persica] Length = 495 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 306 PQISGARVDEVCR*IDFNGILRVDADGFFGGIWLIWRTSEVVVHPISLHPQHITVKIS 133 P+IS + + + + F+ VDA GF GG+WL+W ++V V + Q I+ ++ Sbjct: 360 PRISSGKATSIAQSLGFSNFEIVDATGFSGGLWLLWDATKVHVDILGTSDQSISASVA 417 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -2 Query: 125 GEEHWILSAIYASPNPSSRVALSDQLVDFARINNRPWLLAG 3 G+ W+ +A+YASP R L + L A + PWL+AG Sbjct: 420 GQSPWLFTAVYASPCGIKRAKLWEYLSFIADCQHLPWLIAG 460 >gb|EOY08210.1| Uncharacterized protein TCM_022554 [Theobroma cacao] Length = 669 Score = 39.3 bits (90), Expect(2) = 1e-05 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 306 PQISGARVDEVCR*IDFNGILRVDADGFFGGIWLIWRTSEVVVHPISLHPQ--HITVK 139 P+ISG D + + F+ RV+ GF GGIW +W+ V +H I H Q H+T++ Sbjct: 278 PRISGRLADGTIKQLGFDYSHRVEFVGFSGGIWCLWK-ENVKLHIIKNHNQCVHMTIE 334 Score = 35.4 bits (80), Expect(2) = 1e-05 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 119 EHWILSAIYASPNPSSRVALSDQLVDFARINNRPWLLA 6 E W + +Y +P+P+ R L ++L F PWLLA Sbjct: 339 EFWFFTTVYGNPSPNIRCQLWEELSSFENTVTGPWLLA 376