BLASTX nr result
ID: Rheum21_contig00037191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037191 (461 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512122.1| pentatricopeptide repeat-containing protein,... 91 2e-16 ref|XP_002274857.1| PREDICTED: putative pentatricopeptide repeat... 83 4e-14 emb|CAN65041.1| hypothetical protein VITISV_009461 [Vitis vinifera] 83 4e-14 ref|XP_006391028.1| hypothetical protein EUTSA_v10019580mg [Eutr... 81 1e-13 ref|NP_564961.1| pentatricopeptide repeat-containing protein [Ar... 81 1e-13 ref|XP_006438782.1| hypothetical protein CICLE_v10033549mg [Citr... 81 2e-13 ref|XP_002887230.1| hypothetical protein ARALYDRAFT_476061 [Arab... 81 2e-13 gb|EMJ25777.1| hypothetical protein PRUPE_ppa1027222mg [Prunus p... 80 3e-13 gb|EOY01787.1| Pentatricopeptide repeat-containing protein, puta... 80 4e-13 ref|XP_006348719.1| PREDICTED: putative pentatricopeptide repeat... 78 1e-12 ref|XP_004239080.1| PREDICTED: putative pentatricopeptide repeat... 77 2e-12 ref|XP_004490134.1| PREDICTED: putative pentatricopeptide repeat... 76 4e-12 ref|XP_006301926.1| hypothetical protein CARUB_v10022402mg [Caps... 76 4e-12 gb|EXB65067.1| hypothetical protein L484_004243 [Morus notabilis] 76 5e-12 ref|XP_003517819.1| PREDICTED: putative pentatricopeptide repeat... 75 9e-12 ref|XP_003613989.1| hypothetical protein MTR_5g043450 [Medicago ... 73 3e-11 gb|ESW29424.1| hypothetical protein PHAVU_002G069500g [Phaseolus... 72 8e-11 ref|XP_004158293.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 71 2e-10 ref|XP_004144264.1| PREDICTED: putative pentatricopeptide repeat... 71 2e-10 ref|XP_002312273.1| pentatricopeptide repeat-containing family p... 70 2e-10 >ref|XP_002512122.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549302|gb|EEF50791.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 800 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/83 (51%), Positives = 65/83 (78%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D+IR+IE+DL+++ + D+GYYTLLSNI+AE +WD S+++RS M +GLKKVPGYS Sbjct: 683 HQRMDMIRNIERDLLDMRTDDTGYYTLLSNIYAEEGNWDVSRKVRSAMKGIGLKKVPGYS 742 Query: 279 TIKN*HLLMLIQLIQFSAGEMFH 211 TI+ + ++ +F AG++ H Sbjct: 743 TIE-----LDKKVYRFGAGDVSH 760 >ref|XP_002274857.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial [Vitis vinifera] Length = 875 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/86 (47%), Positives = 64/86 (74%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+RID+I+SIE++L+++ + D+GYYTLLSNI+AE WD+ ++RS+M S GL+KVPGYS Sbjct: 685 HKRIDIIKSIEKNLLDVDTADTGYYTLLSNIYAEEGTWDKFGKVRSMMKSKGLRKVPGYS 744 Query: 279 TIKN*HLLMLIQLIQFSAGEMFH*RT 202 TI+ + ++ +F G+ H +T Sbjct: 745 TIE-----IDKKIYRFGPGDTSHSQT 765 >emb|CAN65041.1| hypothetical protein VITISV_009461 [Vitis vinifera] Length = 1072 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/86 (47%), Positives = 64/86 (74%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+RID+I+SIE++L+++ + D+GYYTLLSNI+AE WD+ ++RS+M S GL+KVPGYS Sbjct: 882 HKRIDIIKSIEKNLLDVDTADTGYYTLLSNIYAEEGTWDKFGKVRSMMKSKGLRKVPGYS 941 Query: 279 TIKN*HLLMLIQLIQFSAGEMFH*RT 202 TI+ + ++ +F G+ H +T Sbjct: 942 TIE-----IDKKIYRFGPGDTSHSQT 962 >ref|XP_006391028.1| hypothetical protein EUTSA_v10019580mg [Eutrema salsugineum] gi|557087462|gb|ESQ28314.1| hypothetical protein EUTSA_v10019580mg [Eutrema salsugineum] Length = 787 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/80 (48%), Positives = 60/80 (75%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D++++I++DL ++ + D+GYYTLLSNI+AE +W+E +R+RS M S LKKVPGYS Sbjct: 683 HQRMDMVKAIKEDLSDIVTDDTGYYTLLSNIYAEEGEWEEFRRMRSAMKSSSLKKVPGYS 742 Query: 279 TIKN*HLLMLIQLIQFSAGE 220 I+ + ++ +F AGE Sbjct: 743 VIE-----IDQKVFRFGAGE 757 >ref|NP_564961.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75168871|sp|Q9C507.1|PP111_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial; Flags: Precursor gi|12325094|gb|AAG52503.1|AC018364_21 hypothetical protein; 27026-24663 [Arabidopsis thaliana] gi|12597785|gb|AAG60097.1|AC073178_8 PPR-repeat protein, putative [Arabidopsis thaliana] gi|332196793|gb|AEE34914.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 787 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/80 (50%), Positives = 59/80 (73%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQ++D+I++I+ DL ++ + D+GYYTLLSNI+AE +W+E +RLRS M S LKKVPGYS Sbjct: 685 HQKMDIIKAIKNDLSDIVTDDTGYYTLLSNIYAEEGEWEEFRRLRSAMKSSNLKKVPGYS 744 Query: 279 TIKN*HLLMLIQLIQFSAGE 220 I+ + ++ +F AGE Sbjct: 745 AIE-----IDQKVFRFGAGE 759 >ref|XP_006438782.1| hypothetical protein CICLE_v10033549mg [Citrus clementina] gi|557540978|gb|ESR52022.1| hypothetical protein CICLE_v10033549mg [Citrus clementina] Length = 745 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/62 (59%), Positives = 51/62 (82%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+RIDV+++IE++L + D+GYYTLLSNI+AE +WDE ++RS+M+ GLKKVPGYS Sbjct: 684 HKRIDVMKTIEKELSVTGTNDNGYYTLLSNIYAEEGNWDEFGKVRSIMEVTGLKKVPGYS 743 Query: 279 TI 274 TI Sbjct: 744 TI 745 >ref|XP_002887230.1| hypothetical protein ARALYDRAFT_476061 [Arabidopsis lyrata subsp. lyrata] gi|297333071|gb|EFH63489.1| hypothetical protein ARALYDRAFT_476061 [Arabidopsis lyrata subsp. lyrata] Length = 1347 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/80 (47%), Positives = 60/80 (75%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQ++D+I++I+ D+ ++ + D+GYYTLLSNI+AE +W+E +R+RS M S+ LKKVPGYS Sbjct: 1243 HQKMDIIKAIKNDISDIVTDDTGYYTLLSNIYAEEGEWEEFRRMRSAMKSLNLKKVPGYS 1302 Query: 279 TIKN*HLLMLIQLIQFSAGE 220 I+ + ++ +F AGE Sbjct: 1303 AIE-----IDKKVFRFGAGE 1317 >gb|EMJ25777.1| hypothetical protein PRUPE_ppa1027222mg [Prunus persica] Length = 634 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/63 (57%), Positives = 50/63 (79%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D+I+SIE DL+++ + DSGYYTL SNI+AE +WDE +R +M +GL+KVPGYS Sbjct: 542 HQRMDMIKSIETDLLDISTDDSGYYTLFSNIYAEGGNWDEFGNVRLMMKGIGLRKVPGYS 601 Query: 279 TIK 271 I+ Sbjct: 602 IIE 604 >gb|EOY01787.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 830 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/63 (53%), Positives = 51/63 (80%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H RID+I++IE+DL+++ + D+GYYTLLSN++ E +W E ++RS M +GL+KVPGYS Sbjct: 686 HHRIDMIKTIEKDLLDINTDDTGYYTLLSNVYGEEGNWKEFGKVRSAMKGIGLRKVPGYS 745 Query: 279 TIK 271 TI+ Sbjct: 746 TIE 748 >ref|XP_006348719.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Solanum tuberosum] gi|565405237|ref|XP_006368014.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Solanum tuberosum] Length = 753 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/63 (57%), Positives = 51/63 (80%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+R+D+I+ I+Q L N+ + D+GYYTLLSNI+AE +W+ES+ +RS M S+GLKKV GYS Sbjct: 684 HKRMDIIKMIQQRLKNMQTDDTGYYTLLSNIYAEEGEWNESRMVRSKMRSLGLKKVDGYS 743 Query: 279 TIK 271 I+ Sbjct: 744 MIE 746 >ref|XP_004239080.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Solanum lycopersicum] Length = 753 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/63 (55%), Positives = 51/63 (80%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+R+D+I+ ++Q L N+ + D+GYYTLLSNI+AE +W+ES+ +RS M S+GLKKV GYS Sbjct: 684 HKRMDIIKMMQQRLENMQTDDTGYYTLLSNIYAEEGEWNESRMVRSKMRSLGLKKVDGYS 743 Query: 279 TIK 271 I+ Sbjct: 744 MIE 746 >ref|XP_004490134.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Cicer arietinum] Length = 805 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/63 (55%), Positives = 50/63 (79%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H R+D+I +I ++L + + D+GYYTLLSNI+AE W ES+++RS M+ +GLKKVPGYS Sbjct: 688 HGRLDLIENISEELGGIRTDDTGYYTLLSNIYAEGGKWYESRKVRSRMEGMGLKKVPGYS 747 Query: 279 TIK 271 TI+ Sbjct: 748 TIE 750 >ref|XP_006301926.1| hypothetical protein CARUB_v10022402mg [Capsella rubella] gi|482570636|gb|EOA34824.1| hypothetical protein CARUB_v10022402mg [Capsella rubella] Length = 785 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/80 (46%), Positives = 57/80 (71%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+R+D I++I+ DL ++ + D+GYYTLLSNI+ E +W+E +++RS M S LKKVPGYS Sbjct: 685 HKRMDTIKAIKNDLSDIVTDDTGYYTLLSNIYGEEGEWEEFRKMRSAMKSSNLKKVPGYS 744 Query: 279 TIKN*HLLMLIQLIQFSAGE 220 I+ + ++ +F AGE Sbjct: 745 AIE-----IDKKVFRFGAGE 759 >gb|EXB65067.1| hypothetical protein L484_004243 [Morus notabilis] Length = 792 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/80 (46%), Positives = 57/80 (71%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H+R+D++ SI++D+ ++ + D GYYTLLSNI+AE +WDE ++R M S+GL KVPGYS Sbjct: 682 HRRMDMLNSIQRDISSISTDDPGYYTLLSNIYAEGGNWDEFGKVRLKMKSIGLAKVPGYS 741 Query: 279 TIKN*HLLMLIQLIQFSAGE 220 +I+ + Q +F AG+ Sbjct: 742 SIE-----LENQTYRFGAGD 756 >ref|XP_003517819.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Glycine max] Length = 828 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/63 (53%), Positives = 51/63 (80%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H R+D+I +I ++L + + D+GYYTLLSNI+AE +W ES+++RS M+ +GLKKVPGYS Sbjct: 687 HGRMDLIHNIHKELREIRTNDTGYYTLLSNIYAEGGNWYESRKVRSRMEGMGLKKVPGYS 746 Query: 279 TIK 271 +I+ Sbjct: 747 SIE 749 >ref|XP_003613989.1| hypothetical protein MTR_5g043450 [Medicago truncatula] gi|355515324|gb|AES96947.1| hypothetical protein MTR_5g043450 [Medicago truncatula] Length = 828 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/61 (54%), Positives = 49/61 (80%) Frame = -3 Query: 453 RIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYSTI 274 R+D+I I ++L + + D+GYYTLLSNI+AE +W ES+++RS M+ +GLKKVPGYST+ Sbjct: 690 RMDMIEYIAEELGGISTDDTGYYTLLSNIYAEGGNWYESRKVRSKMEGMGLKKVPGYSTV 749 Query: 273 K 271 + Sbjct: 750 E 750 >gb|ESW29424.1| hypothetical protein PHAVU_002G069500g [Phaseolus vulgaris] Length = 825 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/63 (50%), Positives = 52/63 (82%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 H R+D+I++I ++L + + D+G+YTLLSNI+AE +W ES+++RS M+ +GLKKVPG+S Sbjct: 687 HGRMDLIKNIHKELREIRTDDTGHYTLLSNIYAEGGNWYESRKVRSRMEGLGLKKVPGFS 746 Query: 279 TIK 271 +I+ Sbjct: 747 SIE 749 >ref|XP_004158293.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Cucumis sativus] Length = 804 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/63 (47%), Positives = 48/63 (76%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D+ ++I+++L N+ + D+G+YTLLSNI+A +W+E +RS+M GLKKVP YS Sbjct: 684 HQRMDIAKNIQRELWNIQTDDTGHYTLLSNIYAAGGEWNEFGEVRSMMKGTGLKKVPAYS 743 Query: 279 TIK 271 ++ Sbjct: 744 VVE 746 >ref|XP_004144264.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial-like [Cucumis sativus] Length = 804 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/63 (47%), Positives = 48/63 (76%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D+ ++I+++L N+ + D+G+YTLLSNI+A +W+E +RS+M GLKKVP YS Sbjct: 684 HQRMDIAKNIQRELWNIQTDDTGHYTLLSNIYAAGGEWNEFGEVRSMMKGTGLKKVPAYS 743 Query: 279 TIK 271 ++ Sbjct: 744 VVE 746 >ref|XP_002312273.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222852093|gb|EEE89640.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 745 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/62 (50%), Positives = 45/62 (72%) Frame = -3 Query: 459 HQRIDVIRSIEQDLVNLPSKDSGYYTLLSNIHAEYEDWDESQRLRSVMDSVGLKKVPGYS 280 HQR+D+I IE+DL+ + + D+G+Y+LLSNI+AE +W + R +M+ G KKVPGYS Sbjct: 684 HQRMDMIPEIEKDLLKIRTSDTGHYSLLSNIYAEIGNWAARENTRGIMERSGYKKVPGYS 743 Query: 279 TI 274 I Sbjct: 744 AI 745