BLASTX nr result
ID: Rheum21_contig00037047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00037047 (314 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358601.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_004246180.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002329535.1| predicted protein [Populus trichocarpa] gi|5... 61 2e-07 >ref|XP_006358601.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum tuberosum] Length = 639 Score = 66.2 bits (160), Expect = 4e-09 Identities = 39/63 (61%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -3 Query: 183 PKLWKDIDYASSESNPVNG-SQTLELNHPILLKLDSSTC-LNQFNQAHAQLLVLGLFQHP 10 PKLW D D A S NG TL L+HPIL LDS T L QFNQ HAQL+V G+FQHP Sbjct: 34 PKLWSDHDDAQSFDPYNNGVHSTLTLSHPILRILDSCTPKLRQFNQVHAQLIVSGIFQHP 93 Query: 9 LAA 1 LAA Sbjct: 94 LAA 96 >ref|XP_004246180.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum lycopersicum] Length = 639 Score = 64.7 bits (156), Expect = 1e-08 Identities = 38/63 (60%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -3 Query: 183 PKLWKDIDYASSESNPVNG-SQTLELNHPILLKLDSSTC-LNQFNQAHAQLLVLGLFQHP 10 PKLW D D S NG TL L+HPIL LDS T L QFNQ HAQL+V G+FQHP Sbjct: 34 PKLWSDHDDVQSFDPYNNGVHSTLTLSHPILRILDSCTPKLRQFNQVHAQLIVSGIFQHP 93 Query: 9 LAA 1 LAA Sbjct: 94 LAA 96 >ref|XP_002329535.1| predicted protein [Populus trichocarpa] gi|566161603|ref|XP_006385604.1| hypothetical protein POPTR_0003s08540g [Populus trichocarpa] gi|550342733|gb|ERP63401.1| hypothetical protein POPTR_0003s08540g [Populus trichocarpa] Length = 617 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 4/66 (6%) Frame = -3 Query: 186 PPKLWKDIDYASSESNPVNGSQ---TLELNHPILLKLDSS-TCLNQFNQAHAQLLVLGLF 19 PPKL+ + + ++ S TL+LNHPIL KL+ S T + QFNQ H QL VLGLF Sbjct: 28 PPKLFPNDPTPQQITQTISNSSNAPTLDLNHPILQKLEQSCTNIKQFNQIHTQLTVLGLF 87 Query: 18 QHPLAA 1 QHP AA Sbjct: 88 QHPFAA 93