BLASTX nr result
ID: Rheum21_contig00035859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035859 (306 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531248.1| mixed-lineage leukemia protein, putative [Ri... 48 8e-07 >ref|XP_002531248.1| mixed-lineage leukemia protein, putative [Ricinus communis] gi|223529167|gb|EEF31145.1| mixed-lineage leukemia protein, putative [Ricinus communis] Length = 344 Score = 47.8 bits (112), Expect(2) = 8e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 200 KQHTELWNKQQQTGKFKIVARDEH 129 K HTELW KQQ+TGKFKIVAR+EH Sbjct: 319 KTHTELWKKQQRTGKFKIVAREEH 342 Score = 30.8 bits (68), Expect(2) = 8e-07 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 291 VPCALNRGFCI*YIQGSSSRGMDIIHGFCK 202 V C LN+ FC Y +G G I+ GFCK Sbjct: 291 VTCGLNQDFCFEYKEGRKKEG-TIVAGFCK 319