BLASTX nr result
ID: Rheum21_contig00035636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035636 (238 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL33510.1| protease cofactor [Broad bean wilt virus 2] 57 3e-06 dbj|BAA34928.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 dbj|BAB18312.1| 210kDa protein precursor [Broad bean wilt virus 2] 56 4e-06 gb|AGT50327.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AGO58930.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AGM38166.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AGM38165.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AGM38160.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AAD39217.1|AF149425_1 polyprotein [broad bean wilt virus 2] 56 4e-06 gb|AFW04233.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 dbj|BAM42888.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|AFN44903.1| polyprotein, partial [Broad bean wilt virus 2] 56 4e-06 gb|AEL33509.1| protease cofactor [Broad bean wilt virus 2] 56 4e-06 gb|AEL33508.1| protease cofactor [Broad bean wilt virus 2] 56 4e-06 gb|AEL33507.1| protease cofactor [Broad bean wilt virus 2] gi|34... 56 4e-06 gb|ADW76867.1| polyprotein [Broad bean wilt virus 2] gi|32117131... 56 4e-06 emb|CBN73319.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 gb|ACK86676.1| polyprotein [Broad bean wilt virus 2] 56 4e-06 dbj|BAB83045.1| polyprotein [Patchouli mild mosaic virus] 56 4e-06 gb|AFQ32559.1| precursor polyprotein [Broad bean wilt virus 2] 55 1e-05 >gb|AEL33510.1| protease cofactor [Broad bean wilt virus 2] Length = 47 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQV+VSFLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVLVSFLKTSMGLQSIRDIVQKAKV 31 >dbj|BAA34928.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >dbj|BAB18312.1| 210kDa protein precursor [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AGT50327.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AGO58930.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AGM38166.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AGM38165.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AGM38160.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AAD39217.1|AF149425_1 polyprotein [broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AFW04233.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >dbj|BAM42888.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AFN44903.1| polyprotein, partial [Broad bean wilt virus 2] Length = 55 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AEL33509.1| protease cofactor [Broad bean wilt virus 2] Length = 47 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AEL33508.1| protease cofactor [Broad bean wilt virus 2] Length = 47 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AEL33507.1| protease cofactor [Broad bean wilt virus 2] gi|342731087|gb|AEL33511.1| protease cofactor [Broad bean wilt virus 2] gi|342731089|gb|AEL33512.1| protease cofactor [Broad bean wilt virus 2] gi|342731091|gb|AEL33513.1| protease cofactor [Broad bean wilt virus 2] Length = 47 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|ADW76867.1| polyprotein [Broad bean wilt virus 2] gi|321171316|gb|ADW76868.1| polyprotein [Broad bean wilt virus 2] Length = 55 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >emb|CBN73319.1| polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|ACK86676.1| polyprotein [Broad bean wilt virus 2] Length = 55 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >dbj|BAB83045.1| polyprotein [Patchouli mild mosaic virus] Length = 1870 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQVVV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKV 31 >gb|AFQ32559.1| precursor polyprotein [Broad bean wilt virus 2] Length = 1870 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 145 MEFSTMQVVVSFLKTSMGLQSIRDIVRKAKV 237 M+FSTMQ+VV FLKTSMGLQSIRDIV+KAKV Sbjct: 1 MDFSTMQMVVGFLKTSMGLQSIRDIVQKAKV 31