BLASTX nr result
ID: Rheum21_contig00035616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035616 (233 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29319.1| F-box/kelch-repeat protein [Morus notabilis] 74 2e-11 ref|XP_006351356.1| PREDICTED: F-box/kelch-repeat protein At1g15... 72 1e-10 ref|XP_004249297.1| PREDICTED: F-box/kelch-repeat protein At2g44... 71 2e-10 ref|XP_004249296.1| PREDICTED: F-box/kelch-repeat protein At2g44... 71 2e-10 ref|XP_004303369.1| PREDICTED: F-box/kelch-repeat protein At1g15... 70 3e-10 ref|XP_002281267.2| PREDICTED: F-box/kelch-repeat protein At2g44... 70 3e-10 ref|XP_006488897.1| PREDICTED: F-box/kelch-repeat protein At1g15... 70 4e-10 ref|XP_006445657.1| hypothetical protein CICLE_v10015832mg [Citr... 70 4e-10 gb|EPS68045.1| hypothetical protein M569_06729 [Genlisea aurea] 69 7e-10 gb|EOY09613.1| F-box family protein [Theobroma cacao] 69 9e-10 ref|XP_006429949.1| hypothetical protein CICLE_v10012048mg [Citr... 68 1e-09 gb|EMJ05894.1| hypothetical protein PRUPE_ppa008266mg [Prunus pe... 68 1e-09 ref|XP_002309282.1| hypothetical protein POPTR_0006s21140g [Popu... 68 1e-09 emb|CAN71047.1| hypothetical protein VITISV_015116 [Vitis vinifera] 68 1e-09 gb|EXC04166.1| F-box/kelch-repeat protein [Morus notabilis] 68 1e-09 ref|XP_006481692.1| PREDICTED: F-box/kelch-repeat protein At2g44... 68 1e-09 ref|XP_004296192.1| PREDICTED: F-box/kelch-repeat protein At2g44... 68 1e-09 ref|XP_004142165.1| PREDICTED: F-box/kelch-repeat protein At2g44... 67 2e-09 ref|XP_004136552.1| PREDICTED: F-box/kelch-repeat protein At2g44... 66 6e-09 gb|EMJ06667.1| hypothetical protein PRUPE_ppa007996mg [Prunus pe... 65 7e-09 >gb|EXB29319.1| F-box/kelch-repeat protein [Morus notabilis] Length = 347 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = +1 Query: 67 DQLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 + ELIPG PDD+ALECL+R H+S+H +AA V R WRRL S DFY R+ TGH Sbjct: 3 ESFTELIPGLPDDLALECLTRLHFSTHRVAARVSRRWRRLFQSRDFYYHRKLTGH 57 >ref|XP_006351356.1| PREDICTED: F-box/kelch-repeat protein At1g15670-like [Solanum tuberosum] Length = 343 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +1 Query: 67 DQLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 ++ EL+PG P+D+ALECL+R HYS+H +A+ VCR W R+L S FY R+QTG Sbjct: 4 NEFTELVPGLPEDIALECLTRLHYSTHGVASRVCRRWCRILQSKAFYYHRKQTG 57 >ref|XP_004249297.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like isoform 2 [Solanum lycopersicum] Length = 298 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +1 Query: 67 DQLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 ++ EL+PG P+D+ALECL+R HYS+H +A+ VCR W R+L S FY R+QTG Sbjct: 4 NKFTELLPGLPEDIALECLTRLHYSTHGVASRVCRRWCRILQSKAFYYHRKQTG 57 >ref|XP_004249296.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like isoform 1 [Solanum lycopersicum] Length = 344 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +1 Query: 67 DQLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 ++ EL+PG P+D+ALECL+R HYS+H +A+ VCR W R+L S FY R+QTG Sbjct: 4 NKFTELLPGLPEDIALECLTRLHYSTHGVASRVCRRWCRILQSKAFYYHRKQTG 57 >ref|XP_004303369.1| PREDICTED: F-box/kelch-repeat protein At1g15670-like [Fragaria vesca subsp. vesca] Length = 336 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 ELIPGFP ++A ECL+R HYS+H +A+ VCR W L+ S DFY R+Q+G Sbjct: 5 ELIPGFPQEIAYECLTRLHYSAHRVASRVCRRWGELIKSRDFYNHRKQSG 54 >ref|XP_002281267.2| PREDICTED: F-box/kelch-repeat protein At2g44130 [Vitis vinifera] Length = 355 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 70 QLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 Q ELIPG P+++ALEC +R Y+SH +AA VCR W LL +FY LR+QTG Sbjct: 15 QFTELIPGLPEEIALECFTRLPYTSHRVAAQVCRRWGELLQGKEFYYLRKQTG 67 >ref|XP_006488897.1| PREDICTED: F-box/kelch-repeat protein At1g15670-like [Citrus sinensis] Length = 342 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 ELIP P++++LECL+R YS+H LA++VCR WR+LL S DFY R+ +GH Sbjct: 7 ELIPSLPEELSLECLTRLPYSTHRLASAVCRRWRQLLQSQDFYYQRKNSGH 57 >ref|XP_006445657.1| hypothetical protein CICLE_v10015832mg [Citrus clementina] gi|557548268|gb|ESR58897.1| hypothetical protein CICLE_v10015832mg [Citrus clementina] Length = 342 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 ELIP P++++LECL+R YS+H LA++VCR WR+LL S DFY R+ +GH Sbjct: 7 ELIPSLPEELSLECLTRLPYSTHRLASAVCRRWRQLLQSQDFYYQRKNSGH 57 >gb|EPS68045.1| hypothetical protein M569_06729 [Genlisea aurea] Length = 349 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +1 Query: 76 QELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 +EL+P PDDVALECL+R H+S H AASVCR WR L S +FY R++ G Sbjct: 6 EELLPRLPDDVALECLTRLHFSDHRSAASVCRRWRNLFRSKEFYYHRKKLG 56 >gb|EOY09613.1| F-box family protein [Theobroma cacao] Length = 343 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +1 Query: 73 LQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 L ELIP P+++ LECL+R HYS+H ++A VCR W+ LL S FY R++TG+ Sbjct: 7 LSELIPALPEEIGLECLTRFHYSTHRMSARVCRRWQELLQSRQFYYHRKKTGY 59 >ref|XP_006429949.1| hypothetical protein CICLE_v10012048mg [Citrus clementina] gi|557532006|gb|ESR43189.1| hypothetical protein CICLE_v10012048mg [Citrus clementina] Length = 358 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/53 (50%), Positives = 40/53 (75%) Frame = +1 Query: 70 QLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 + EL+PG P++++LECL+R HYS+H +A V R WR+L+ S DFY R+Q+G Sbjct: 22 EFAELVPGLPEEISLECLTRLHYSTHRVATRVSRRWRQLIQSRDFYYQRKQSG 74 >gb|EMJ05894.1| hypothetical protein PRUPE_ppa008266mg [Prunus persica] Length = 339 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = +1 Query: 70 QLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 Q+ ELIPG P+++ ECL+R HYS+H +A+ VCR W+ +L S DFY R+Q+G Sbjct: 2 QMTELIPGLPEELGHECLTRLHYSTHRVASRVCRRWQDMLQSLDFYNHRKQSG 54 >ref|XP_002309282.1| hypothetical protein POPTR_0006s21140g [Populus trichocarpa] gi|222855258|gb|EEE92805.1| hypothetical protein POPTR_0006s21140g [Populus trichocarpa] Length = 337 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 73 LQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 + ELIP PD++ALECL R HY++H +A+ VC+ WR +L S DFY R+Q G Sbjct: 1 MTELIPSLPDEIALECLFRLHYTTHRVASQVCKRWRPVLQSRDFYYQRKQNG 52 >emb|CAN71047.1| hypothetical protein VITISV_015116 [Vitis vinifera] Length = 343 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 70 QLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 Q ELIPG P+++ALEC +R Y+SH +AA VCR W LL +FY R+QTG Sbjct: 3 QFTELIPGLPEEIALECFTRLPYTSHRVAAQVCRRWGELLQGKEFYYXRKQTG 55 >gb|EXC04166.1| F-box/kelch-repeat protein [Morus notabilis] Length = 357 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 ELIPG PD++ LECL+R Y +H +A+ VCR WR L+ S +F+ LRR GH Sbjct: 12 ELIPGLPDELGLECLTRLPYQTHRVASRVCRRWRSLIESREFHHLRRTNGH 62 >ref|XP_006481692.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like [Citrus sinensis] Length = 358 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/50 (54%), Positives = 39/50 (78%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 EL+PG P++++LECL+R HYS+H +A V R WR+L+ S DFY R+Q+G Sbjct: 25 ELVPGLPEEISLECLTRLHYSTHRVATRVSRRWRQLIQSRDFYYQRKQSG 74 >ref|XP_004296192.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like [Fragaria vesca subsp. vesca] Length = 348 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = +1 Query: 64 IDQLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 I ++ E IPG P+D+ LECL+R YS+H +A+ VCR WR LL S DFY R++ G+ Sbjct: 3 IPEVPEWIPGLPEDLGLECLTRLPYSAHPIASRVCRPWRSLLESKDFYHHRKRNGY 58 >ref|XP_004142165.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like [Cucumis sativus] Length = 347 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/50 (52%), Positives = 41/50 (82%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 E IPG P++++L+C++R Y+SH LA++VCR W++L+ SPDFY RR++G Sbjct: 10 EFIPGLPEELSLDCITRLPYTSHRLASAVCRRWQQLISSPDFYYHRRKSG 59 >ref|XP_004136552.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like [Cucumis sativus] gi|449516347|ref|XP_004165208.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like isoform 1 [Cucumis sativus] gi|449516349|ref|XP_004165209.1| PREDICTED: F-box/kelch-repeat protein At2g44130-like isoform 2 [Cucumis sativus] Length = 341 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +1 Query: 79 ELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTG 228 ELIPG P+++ALECL+RSH+++H +AA V R W RL S FY LR+ +G Sbjct: 7 ELIPGLPEEIALECLTRSHFTTHRVAARVSRRWHRLFLSRHFYNLRKLSG 56 >gb|EMJ06667.1| hypothetical protein PRUPE_ppa007996mg [Prunus persica] Length = 349 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/54 (50%), Positives = 38/54 (70%) Frame = +1 Query: 70 QLQELIPGFPDDVALECLSRSHYSSHHLAASVCRAWRRLLHSPDFYRLRRQTGH 231 +L +L PG P+++ LECL+R YS+H +A+ VCR WR LL S FY R++ GH Sbjct: 5 KLTQLFPGLPEELGLECLTRLPYSAHPVASQVCRPWRTLLESQQFYHHRKKNGH 58