BLASTX nr result
ID: Rheum21_contig00035272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035272 (215 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316169.2| hypothetical protein POPTR_0010s18600g [Popu... 57 3e-06 >ref|XP_002316169.2| hypothetical protein POPTR_0010s18600g [Populus trichocarpa] gi|550330099|gb|EEF02340.2| hypothetical protein POPTR_0010s18600g [Populus trichocarpa] Length = 491 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 81 MAKKPISNGNGSWIPDKEVSRSDFPHNFLFGVATSAYQVEGASKE 215 MAKK ++ +KEVSRSDFP +F+FGVATSAYQ+EGAS E Sbjct: 1 MAKKEEFLKEHEYLNEKEVSRSDFPPDFIFGVATSAYQIEGASNE 45