BLASTX nr result
ID: Rheum21_contig00035013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00035013 (438 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006660737.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 >ref|XP_006660737.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Oryza brachyantha] Length = 816 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -1 Query: 438 AFLNLRWCAIMGSVLTWEPDKSPWSRRLSSAYKGH 334 A LNLRWCAIMGS ++W P+ S W+RRL+S+Y G+ Sbjct: 766 ALLNLRWCAIMGSTISWSPEDSLWARRLASSYDGN 800