BLASTX nr result
ID: Rheum21_contig00034911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034911 (593 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY06403.1| Serine/threonine-protein kinase isoform 1 [Theobr... 58 2e-06 ref|XP_006594475.1| PREDICTED: cytokinesis protein sepA-like iso... 57 5e-06 >gb|EOY06403.1| Serine/threonine-protein kinase isoform 1 [Theobroma cacao] Length = 792 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Frame = +1 Query: 115 WPP-----VGLFGSLCNALSSCLYVVCCCWLIHDCFG 210 WP VG F LC+ +SSCLYV+CCCWLI DCFG Sbjct: 600 WPAPGGLIVGFFNGLCSGVSSCLYVLCCCWLIQDCFG 636 >ref|XP_006594475.1| PREDICTED: cytokinesis protein sepA-like isoform X1 [Glycine max] Length = 120 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 5/39 (12%) Frame = +1 Query: 112 AWP-PVGLFGS----LCNALSSCLYVVCCCWLIHDCFGA 213 +WP P L G+ LCN +SSC Y+VCCCWL+ DCFGA Sbjct: 17 SWPGPPSLLGNFFNGLCNTISSCFYIVCCCWLLQDCFGA 55