BLASTX nr result
ID: Rheum21_contig00034780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034780 (225 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152557.1| PREDICTED: uncharacterized protein LOC101203... 55 1e-05 >ref|XP_004152557.1| PREDICTED: uncharacterized protein LOC101203045 [Cucumis sativus] gi|449487859|ref|XP_004157836.1| PREDICTED: uncharacterized protein LOC101223623 [Cucumis sativus] Length = 371 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -2 Query: 212 DSEQGNNASLSNGYPKSFNLQANRN---HLPRKIAGFWANVFQIIFQMNVWAVMLTDSIF 42 D+EQG +A + + ++R+ HL R+ AGFW VFQIIFQMN AVMLTD +F Sbjct: 167 DAEQGTSAGGNGSITSNTEKNSSRHEEHHLVRQRAGFWGYVFQIIFQMNAGAVMLTDCVF 226