BLASTX nr result
ID: Rheum21_contig00034738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034738 (1094 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago ... 54 3e-13 ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago ... 54 3e-13 ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago ... 54 3e-13 ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago ... 54 3e-13 ref|XP_002535405.1| conserved hypothetical protein [Ricinus comm... 57 1e-05 >ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago truncatula] gi|355480608|gb|AES61811.1| hypothetical protein MTR_1g088800 [Medicago truncatula] Length = 218 Score = 54.3 bits (129), Expect(3) = 3e-13 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 528 LKAYPKDRSSYLYCLSNPKTLIRGGVLRVG 617 L++ P DRSSYLYCLSNPK LIRGGVLRVG Sbjct: 157 LESRPTDRSSYLYCLSNPKILIRGGVLRVG 186 Score = 38.1 bits (87), Expect(3) = 3e-13 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 4/29 (13%) Frame = +1 Query: 616 DPIPS-QLLPDP---PLKLECLSRGDCPR 690 DPIP+ ++LPDP PLKLECLSRG PR Sbjct: 188 DPIPAVKVLPDPAHLPLKLECLSRGGYPR 216 Score = 30.0 bits (66), Expect(3) = 3e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 503 PDGVVHLCLESLP 541 PDGVVHLCLES P Sbjct: 149 PDGVVHLCLESRP 161 >ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago truncatula] gi|355477444|gb|AES58647.1| hypothetical protein MTR_1g006790 [Medicago truncatula] Length = 179 Score = 54.3 bits (129), Expect(3) = 3e-13 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 528 LKAYPKDRSSYLYCLSNPKTLIRGGVLRVG 617 L++ P DRSSYLYCLSNPK LIRGGVLRVG Sbjct: 118 LESRPTDRSSYLYCLSNPKILIRGGVLRVG 147 Score = 38.1 bits (87), Expect(3) = 3e-13 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 4/29 (13%) Frame = +1 Query: 616 DPIPS-QLLPDP---PLKLECLSRGDCPR 690 DPIP+ ++LPDP PLKLECLSRG PR Sbjct: 149 DPIPAVKVLPDPAHLPLKLECLSRGGYPR 177 Score = 30.0 bits (66), Expect(3) = 3e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 503 PDGVVHLCLESLP 541 PDGVVHLCLES P Sbjct: 110 PDGVVHLCLESRP 122 >ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago truncatula] gi|355477342|gb|AES58545.1| hypothetical protein MTR_1g005480 [Medicago truncatula] Length = 179 Score = 54.3 bits (129), Expect(3) = 3e-13 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 528 LKAYPKDRSSYLYCLSNPKTLIRGGVLRVG 617 L++ P DRSSYLYCLSNPK LIRGGVLRVG Sbjct: 118 LESRPTDRSSYLYCLSNPKILIRGGVLRVG 147 Score = 38.1 bits (87), Expect(3) = 3e-13 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 4/29 (13%) Frame = +1 Query: 616 DPIPS-QLLPDP---PLKLECLSRGDCPR 690 DPIP+ ++LPDP PLKLECLSRG PR Sbjct: 149 DPIPAVKVLPDPAHLPLKLECLSRGGYPR 177 Score = 30.0 bits (66), Expect(3) = 3e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 503 PDGVVHLCLESLP 541 PDGVVHLCLES P Sbjct: 110 PDGVVHLCLESRP 122 >ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago truncatula] gi|355477366|gb|AES58569.1| hypothetical protein MTR_1g005920 [Medicago truncatula] Length = 178 Score = 54.3 bits (129), Expect(3) = 3e-13 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 528 LKAYPKDRSSYLYCLSNPKTLIRGGVLRVG 617 L++ P DRSSYLYCLSNPK LIRGGVLRVG Sbjct: 117 LESRPTDRSSYLYCLSNPKILIRGGVLRVG 146 Score = 38.1 bits (87), Expect(3) = 3e-13 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 4/29 (13%) Frame = +1 Query: 616 DPIPS-QLLPDP---PLKLECLSRGDCPR 690 DPIP+ ++LPDP PLKLECLSRG PR Sbjct: 148 DPIPAVKVLPDPAHLPLKLECLSRGGYPR 176 Score = 30.0 bits (66), Expect(3) = 3e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 503 PDGVVHLCLESLP 541 PDGVVHLCLES P Sbjct: 109 PDGVVHLCLESRP 121 >ref|XP_002535405.1| conserved hypothetical protein [Ricinus communis] gi|223523223|gb|EEF26979.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 57.4 bits (137), Expect = 1e-05 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = -3 Query: 417 KSLPGRPTGLYVWS--NLKLGLRRVPLNYRSIIINNTRKWILLPA 289 + +P RPTGLYVW +LKLGL RVP YRSIIINNTRK + PA Sbjct: 22 EKIPSRPTGLYVWVLFHLKLGLGRVPFFYRSIIINNTRKEMDSPA 66