BLASTX nr result
ID: Rheum21_contig00034605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034605 (211 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633227.1| PREDICTED: serine/threonine-protein phosphat... 59 9e-07 emb|CBI31776.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002262668.1| PREDICTED: serine/threonine-protein phosphat... 57 3e-06 >ref|XP_003633227.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Vitis vinifera] Length = 659 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 100 MDLYAFNPGPLDESVLYDQKKHVSSTVWEGQ 8 MD Y NPGP+DESVLYDQ KHVSS VWEGQ Sbjct: 1 MDFYVTNPGPIDESVLYDQDKHVSSAVWEGQ 31 >emb|CBI31776.3| unnamed protein product [Vitis vinifera] Length = 867 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 100 MDLYAFNPGPLDESVLYDQKKHVSSTVWEGQ 8 MD Y NPGP+DESVLYDQ KHVSS VWEGQ Sbjct: 1 MDFYVTNPGPIDESVLYDQDKHVSSAVWEGQ 31 >ref|XP_002262668.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Vitis vinifera] gi|296090639|emb|CBI41033.3| unnamed protein product [Vitis vinifera] Length = 630 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 100 MDLYAFNPGPLDESVLYDQKKHVSSTVWEGQ 8 MDLY +PGP+D+SVLYDQ KHVSS VWEGQ Sbjct: 1 MDLYVTSPGPIDQSVLYDQDKHVSSAVWEGQ 31