BLASTX nr result
ID: Rheum21_contig00034604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034604 (272 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 3... 61 1e-07 emb|CBI38656.3| unnamed protein product [Vitis vinifera] 61 1e-07 emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera] 61 1e-07 ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus c... 55 1e-05 >ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 35-like [Vitis vinifera] Length = 804 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 271 SRKVKGQVLSALISECTPRFCTVYIVSKGKLESLRPSE 158 SRKVKGQ LS ISECTP FCTVY VSKG+L S+RPS+ Sbjct: 148 SRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSD 185 >emb|CBI38656.3| unnamed protein product [Vitis vinifera] Length = 784 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 271 SRKVKGQVLSALISECTPRFCTVYIVSKGKLESLRPSE 158 SRKVKGQ LS ISECTP FCTVY VSKG+L S+RPS+ Sbjct: 148 SRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSD 185 >emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera] Length = 804 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 271 SRKVKGQVLSALISECTPRFCTVYIVSKGKLESLRPSE 158 SRKVKGQ LS ISECTP FCTVY VSKG+L S+RPS+ Sbjct: 148 SRKVKGQSLSLRISECTPSFCTVYTVSKGQLSSVRPSD 185 >ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus communis] gi|223524795|gb|EEF27713.1| hypothetical protein RCOM_2090500 [Ricinus communis] Length = 364 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 271 SRKVKGQVLSALISECTPRFCTVYIVSKGKLESLRPSE 158 +RK KG LS+ IS+C P FCTVY VSKGKL S+RPS+ Sbjct: 148 TRKPKGNNLSSRISDCIPNFCTVYAVSKGKLSSIRPSD 185