BLASTX nr result
ID: Rheum21_contig00034427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00034427 (336 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69295.1| hypothetical protein M569_05471 [Genlisea aurea] 56 6e-06 gb|EOY32749.1| Zinc finger family protein / RNA recognition moti... 55 7e-06 gb|EPS64223.1| hypothetical protein M569_10558, partial [Genlise... 55 1e-05 >gb|EPS69295.1| hypothetical protein M569_05471 [Genlisea aurea] Length = 426 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 109 MDSYESARAVFSRIQSVDPDNASKIIAYILLQDQAE 2 MDSYE+ + V SRIQ +DPDNASKI+ YIL+QDQ E Sbjct: 1 MDSYEATKVVMSRIQCLDPDNASKIMGYILIQDQGE 36 >gb|EOY32749.1| Zinc finger family protein / RNA recognition motif-containing protein, putative [Theobroma cacao] Length = 699 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 109 MDSYESARAVFSRIQSVDPDNASKIIAYILLQDQAE 2 MDSYE+ R VFSRIQ++DP+NASKI+ Y+L+QD E Sbjct: 1 MDSYEATRIVFSRIQNLDPENASKIMGYLLIQDHGE 36 >gb|EPS64223.1| hypothetical protein M569_10558, partial [Genlisea aurea] Length = 525 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 109 MDSYESARAVFSRIQSVDPDNASKIIAYILLQDQAE 2 MDSYE+ + V SRIQ++DP+NASKI+ YIL+QDQ E Sbjct: 1 MDSYEATKVVMSRIQTLDPENASKIMGYILIQDQGE 36