BLASTX nr result
ID: Rheum21_contig00033806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00033806 (947 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522823.1| conserved hypothetical protein [Ricinus comm... 77 7e-12 ref|XP_002530751.1| conserved hypothetical protein [Ricinus comm... 76 2e-11 ref|XP_002526235.1| conserved hypothetical protein [Ricinus comm... 73 1e-10 >ref|XP_002522823.1| conserved hypothetical protein [Ricinus communis] gi|223537907|gb|EEF39521.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 77.4 bits (189), Expect = 7e-12 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 5/72 (6%) Frame = +3 Query: 201 MTETRAQVASRETVSREMEEMFNSKIASIEGRLEEKIDSKLVQFEETLKSGLAEMFEAF- 377 M ETR+Q RE +REM+E FNSKIA +EG+LEEKI+SKL + +E LKS +AEMF+AF Sbjct: 1 MVETRSQALLREGATREMDETFNSKIAVVEGKLEEKINSKLSEIDECLKSRMAEMFKAFE 60 Query: 378 ----GTAAGNGR 401 G NGR Sbjct: 61 LFTNGALTSNGR 72 >ref|XP_002530751.1| conserved hypothetical protein [Ricinus communis] gi|223529667|gb|EEF31611.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 76.3 bits (186), Expect = 2e-11 Identities = 41/72 (56%), Positives = 52/72 (72%), Gaps = 5/72 (6%) Frame = +3 Query: 201 MTETRAQVASRETVSREMEEMFNSKIASIEGRLEEKIDSKLVQFEETLKSGLAEMFEAF- 377 M ET +Q RE +REMEE FNSKIA++EG+LEEKI+SKL + +E LKS +A+MFEAF Sbjct: 1 MVETHSQTLLREGATREMEETFNSKIAAMEGKLEEKINSKLSEIDECLKSRMAKMFEAFE 60 Query: 378 ----GTAAGNGR 401 G + NGR Sbjct: 61 LFINGASTLNGR 72 >ref|XP_002526235.1| conserved hypothetical protein [Ricinus communis] gi|223534474|gb|EEF36176.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 73.2 bits (178), Expect = 1e-10 Identities = 37/59 (62%), Positives = 44/59 (74%) Frame = +3 Query: 201 MTETRAQVASRETVSREMEEMFNSKIASIEGRLEEKIDSKLVQFEETLKSGLAEMFEAF 377 M ET Q RE +REMEE FNSKI ++EG+LEEKIDSKL + +E LKS + EMFEAF Sbjct: 1 MAETCLQALLREGATREMEETFNSKIVAMEGKLEEKIDSKLSEIDECLKSRMTEMFEAF 59