BLASTX nr result
ID: Rheum21_contig00033763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00033763 (277 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324255.1| pentatricopeptide repeat-containing family p... 82 7e-14 ref|XP_006360941.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_004247963.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_002516590.1| pentatricopeptide repeat-containing protein,... 81 2e-13 ref|XP_006481440.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_006476161.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_006450596.1| hypothetical protein CICLE_v10010742mg [Citr... 79 5e-13 ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 emb|CBI20961.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002282128.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 gb|EXC32781.1| hypothetical protein L484_019895 [Morus notabilis] 76 4e-12 ref|XP_002884209.1| pentatricopeptide repeat-containing protein ... 75 1e-11 gb|EMJ28472.1| hypothetical protein PRUPE_ppa017736mg [Prunus pe... 73 3e-11 ref|XP_003631788.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 73 3e-11 ref|NP_179644.1| mitochondrial editing factor 21 [Arabidopsis th... 73 3e-11 ref|XP_006408981.1| hypothetical protein EUTSA_v10001958mg [Eutr... 73 4e-11 ref|XP_004501200.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 gb|ESW09151.1| hypothetical protein PHAVU_009G104600g [Phaseolus... 72 1e-10 ref|XP_004292867.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_006299486.1| hypothetical protein CARUB_v10015651mg [Caps... 70 3e-10 >ref|XP_002324255.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865689|gb|EEF02820.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 547 Score = 82.0 bits (201), Expect = 7e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRTH NL++A IAMEHL E EPDDTGNYV+LS Y Sbjct: 417 KPDSKIWGSLLSSCRTHSNLDIAIIAMEHLEELEPDDTGNYVLLSNIY 464 >ref|XP_006360941.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Solanum tuberosum] Length = 536 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWGSLLSSCRTHRNL +A IAMEHLLE EP+DTGNY++L+ Y Sbjct: 410 KPDSAIWGSLLSSCRTHRNLEIAVIAMEHLLELEPEDTGNYILLANIY 457 >ref|XP_004247963.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Solanum lycopersicum] Length = 534 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWGSLLSSCRTHRNL +A IAMEHLLE EP+DTGNY++L+ Y Sbjct: 408 KPDSAIWGSLLSSCRTHRNLEIAVIAMEHLLELEPEDTGNYILLANIY 455 >ref|XP_002516590.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544410|gb|EEF45931.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRTH N+ VA IAMEHL E EPDDTGNYV+LS Y Sbjct: 393 KPDSKIWGSLLSSCRTHCNIEVAVIAMEHLEELEPDDTGNYVLLSNIY 440 >ref|XP_006481440.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like, partial [Citrus sinensis] Length = 436 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PDAKIWGSLLSSCRT+ NL +A IAMEHLL EP+DTGNYV+LS Y Sbjct: 310 KPDAKIWGSLLSSCRTYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 357 >ref|XP_006476161.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Citrus sinensis] Length = 541 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PDAKIWGSLLSSCRT+ NL +A IAMEHLL EP+DTGNYV+LS Y Sbjct: 415 KPDAKIWGSLLSSCRTYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 462 >ref|XP_006450596.1| hypothetical protein CICLE_v10010742mg [Citrus clementina] gi|557553822|gb|ESR63836.1| hypothetical protein CICLE_v10010742mg [Citrus clementina] Length = 605 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PDAKIWGSLLSSCRT+ NL +A IAMEHLL EP+DTGNYV+LS Y Sbjct: 415 KPDAKIWGSLLSSCRTYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 462 >ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Vitis vinifera] Length = 541 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWGSLLSSCR+H NL +A IAMEHLLE EP DTGNYV+LS Y Sbjct: 415 KPDSAIWGSLLSSCRSHSNLEIAVIAMEHLLELEPADTGNYVLLSNLY 462 >emb|CBI20961.3| unnamed protein product [Vitis vinifera] Length = 553 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWGSLLSSCR+H NL +A IAMEHLLE EP DTGNYV+LS Y Sbjct: 431 KPDSPIWGSLLSSCRSHGNLKIAVIAMEHLLELEPADTGNYVLLSNLY 478 >ref|XP_002282128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 [Vitis vinifera] Length = 537 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWGSLLSSCR+H NL +A IAMEHLLE EP DTGNYV+LS Y Sbjct: 415 KPDSPIWGSLLSSCRSHGNLKIAVIAMEHLLELEPADTGNYVLLSNLY 462 >gb|EXC32781.1| hypothetical protein L484_019895 [Morus notabilis] Length = 549 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLL+SCR H N+ +A +AMEHLLE EPDD GNYV+LS Y Sbjct: 417 KPDSKIWGSLLNSCRIHCNVEIAIVAMEHLLEIEPDDIGNYVLLSNVY 464 >ref|XP_002884209.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330049|gb|EFH60468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 534 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRT NL+VA +AM+HL+E EPDD GNYV+L+ Y Sbjct: 407 KPDSKIWGSLLSSCRTKGNLDVALVAMDHLVEVEPDDMGNYVLLANIY 454 >gb|EMJ28472.1| hypothetical protein PRUPE_ppa017736mg [Prunus persica] Length = 544 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +P++KIWGSLLSSCRTH NL +A AMEHL EPDD GNYV+LS Y Sbjct: 415 KPESKIWGSLLSSCRTHCNLEIAITAMEHLSVLEPDDAGNYVLLSNIY 462 >ref|XP_003631788.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g20540-like [Vitis vinifera] Length = 515 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+ IWG L SSCR+H NL + IAMEHLLE EPDDTGNY+ LS Y Sbjct: 389 KPDSDIWGLLSSSCRSHGNLEIVAIAMEHLLELEPDDTGNYITLSNLY 436 >ref|NP_179644.1| mitochondrial editing factor 21 [Arabidopsis thaliana] gi|75337271|sp|Q9SIL5.1|PP165_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g20540 gi|4586036|gb|AAD25654.1| unknown protein [Arabidopsis thaliana] gi|67633530|gb|AAY78689.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|330251931|gb|AEC07025.1| mitochondrial editing factor 21 [Arabidopsis thaliana] Length = 534 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRT NL+VA +AM+HL+E EP+D GNYV+L+ Y Sbjct: 407 KPDSKIWGSLLSSCRTPGNLDVALVAMDHLVELEPEDMGNYVLLANIY 454 >ref|XP_006408981.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum] gi|557110137|gb|ESQ50434.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum] Length = 531 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRT NL+VA +AM HL E EP+D GNYV LS Y Sbjct: 407 KPDSKIWGSLLSSCRTRGNLDVALVAMHHLAELEPEDMGNYVQLSNIY 454 >ref|XP_004501200.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X1 [Cicer arietinum] gi|502132029|ref|XP_004501201.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X2 [Cicer arietinum] gi|502132032|ref|XP_004501202.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X3 [Cicer arietinum] gi|502132034|ref|XP_004501203.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like isoform X4 [Cicer arietinum] Length = 553 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/64 (51%), Positives = 44/64 (68%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNYGAFFLELLFDTE 96 +PD++IW SLLSSCR HRNL +A IAM+ LLE EP+++GNYV+L+ Y E Sbjct: 409 KPDSRIWNSLLSSCRIHRNLEIAVIAMQQLLELEPEESGNYVLLANIY----------AE 458 Query: 95 MNKW 84 + KW Sbjct: 459 LGKW 462 >gb|ESW09151.1| hypothetical protein PHAVU_009G104600g [Phaseolus vulgaris] Length = 527 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/64 (50%), Positives = 44/64 (68%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNYGAFFLELLFDTE 96 +PD++IW +LLSSCR HRNL +A +AME LLE EP+++GNYV+L+ Y E Sbjct: 406 QPDSRIWNTLLSSCRIHRNLEIAAVAMEQLLELEPEESGNYVLLANIY----------AE 455 Query: 95 MNKW 84 + KW Sbjct: 456 LGKW 459 >ref|XP_004292867.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Fragaria vesca subsp. vesca] Length = 544 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSCRT NL +A IAME L + EPDD GNYV+LS Y Sbjct: 415 KPDSKIWGSLLSSCRTFCNLEIALIAMEQLQDLEPDDAGNYVLLSNIY 462 >ref|XP_006299486.1| hypothetical protein CARUB_v10015651mg [Capsella rubella] gi|482568195|gb|EOA32384.1| hypothetical protein CARUB_v10015651mg [Capsella rubella] Length = 534 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -3 Query: 275 RPDAKIWGSLLSSCRTHRNLNVAEIAMEHLLEFEPDDTGNYVMLSKNY 132 +PD+KIWGSLLSSC+T NL+VA +AM+HL+ EP+D GNYV+L+ Y Sbjct: 407 KPDSKIWGSLLSSCKTQGNLDVALVAMDHLVVLEPEDMGNYVLLANIY 454