BLASTX nr result
ID: Rheum21_contig00033658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00033658 (289 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856965.1| hypothetical protein AMTR_s00832p00002090 [A... 55 7e-06 >ref|XP_006856965.1| hypothetical protein AMTR_s00832p00002090 [Amborella trichopoda] gi|548861001|gb|ERN18432.1| hypothetical protein AMTR_s00832p00002090 [Amborella trichopoda] Length = 498 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/60 (45%), Positives = 34/60 (56%) Frame = -2 Query: 285 WLVPEAVSSIRCYPPKAKRPLGRPRINRYMATWESNYTRKRRCSYCGNQGHNKQYCRRRR 106 W VPE V +I PP + GRP+ R A WE + + +CS CG GHNK+ C RRR Sbjct: 438 WEVPEEVKNIIVLPPHERVKSGRPKTLRRKAGWEKD--QHNKCSKCGELGHNKRTCSRRR 495