BLASTX nr result
ID: Rheum21_contig00031881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031881 (228 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 91 2e-16 ref|XP_004152256.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containi... 90 4e-16 gb|EMJ22511.1| hypothetical protein PRUPE_ppa026098mg [Prunus pe... 86 4e-15 gb|EXB73690.1| hypothetical protein L484_026851 [Morus notabilis] 84 3e-14 ref|XP_003601696.1| Pentatricopeptide repeat-containing protein ... 80 2e-13 ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citr... 79 5e-13 ref|XP_004297007.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 gb|EOY05127.1| Pentatricopeptide repeat (PPR) superfamily protei... 79 8e-13 ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_002520617.1| pentatricopeptide repeat-containing protein,... 78 1e-12 ref|XP_002868318.1| hypothetical protein ARALYDRAFT_330113 [Arab... 77 2e-12 ref|XP_006414819.1| hypothetical protein EUTSA_v10024703mg [Eutr... 77 3e-12 ref|NP_193141.2| pentatricopeptide repeat-containing protein [Ar... 76 5e-12 ref|XP_006283355.1| hypothetical protein CARUB_v10004398mg [Caps... 75 1e-11 ref|XP_002298671.2| pentatricopeptide repeat-containing family p... 74 2e-11 ref|XP_003537521.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 pir||E71401 probable selenium-binding protein - Arabidopsis thal... 74 3e-11 gb|ESW35800.1| hypothetical protein PHAVU_001G265800g [Phaseolus... 74 3e-11 >ref|XP_004156841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Cucumis sativus] Length = 611 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/75 (60%), Positives = 56/75 (74%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF + PV+NL SW+ALISGL+QSGH +F++ N MRRE D VDP +LSS+V G AN A Sbjct: 193 LFLQAPVRNLFSWTALISGLIQSGHGIYSFSLFNEMRREGIDIVDPLVLSSVVGGCANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 LLELGKQIHGLVIAL 267 >ref|XP_004152256.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Cucumis sativus] Length = 611 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/75 (60%), Positives = 56/75 (74%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF + PV+NL SW+ALISGL+QSGH +F++ N MRRE D VDP +LSS+V G AN A Sbjct: 193 LFLQAPVRNLFSWTALISGLIQSGHGIYSFSLFNEMRREGIDIVDPLVLSSVVGGCANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 LLELGKQIHGLVIAL 267 >ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Vitis vinifera] Length = 610 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/75 (60%), Positives = 57/75 (76%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF +MPVKNLLSW+ALISGLVQSG+ +F + MR + D VDP+ILSSI+ +AN A Sbjct: 193 LFQKMPVKNLLSWTALISGLVQSGNWVDSFYLFMEMRSKGIDIVDPFILSSIIGASANLA 252 Query: 46 SLELGKQLHCFVLVL 2 L LGKQ+HC V++L Sbjct: 253 VLGLGKQIHCLVILL 267 >gb|EMJ22511.1| hypothetical protein PRUPE_ppa026098mg [Prunus persica] Length = 610 Score = 86.3 bits (212), Expect = 4e-15 Identities = 44/75 (58%), Positives = 53/75 (70%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 +F+ +P+KNL SW+ALISGLVQSGH AF + MRRE VDP +LSSIV AN A Sbjct: 193 MFESLPIKNLFSWTALISGLVQSGHSVDAFYLFIEMRREGVHIVDPLVLSSIVGACANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 VLELGKQVHSLVIRL 267 >gb|EXB73690.1| hypothetical protein L484_026851 [Morus notabilis] Length = 562 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/75 (54%), Positives = 52/75 (69%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF + P +NL SW+ LISGLVQSG+ AF + M+RE D +DP +LSSIV AN A Sbjct: 194 LFQQAPFRNLFSWTVLISGLVQSGNGIDAFRLFIKMQRENIDIIDPLVLSSIVGACANLA 253 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+HC ++ L Sbjct: 254 VLELGKQVHCLIIAL 268 >ref|XP_003601696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355490744|gb|AES71947.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/75 (54%), Positives = 49/75 (65%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF E P KNL +W+ALISGLVQSG+ A + MRRE DP +LSS+V AN A Sbjct: 199 LFRESPFKNLYAWTALISGLVQSGNANDALYLFVEMRREGVSIADPLVLSSVVGACANSA 258 Query: 46 SLELGKQLHCFVLVL 2 ELGKQ+HC V+ L Sbjct: 259 VRELGKQVHCVVITL 273 >ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] gi|557522907|gb|ESR34274.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] Length = 610 Score = 79.3 bits (194), Expect = 5e-13 Identities = 41/75 (54%), Positives = 52/75 (69%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 +F++ PV+NL W+AL+SGLVQS + AF+ MRRE D VDP +LSSIV AN A Sbjct: 193 IFEQAPVRNLFLWTALVSGLVQSRNEIDAFDSFIEMRREGVDIVDPLVLSSIVGACANFA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 VLELGKQIHGLVIAL 267 >ref|XP_004297007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 610 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/75 (57%), Positives = 52/75 (69%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 +F +MPVK+L SW+ALISGLVQSG+ A + MRRE D VDP +LSS V AN A Sbjct: 193 MFGKMPVKSLFSWTALISGLVQSGNGVDALYLFIEMRRERVDIVDPLVLSSTVGACANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 VLELGKQVHGLVIRL 267 >gb|EOY05127.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 610 Score = 78.6 bits (192), Expect = 8e-13 Identities = 40/75 (53%), Positives = 53/75 (70%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF +P+KNL +W++LISGLVQSG+ AF + MRRE +DP +LSSI+ +AN A Sbjct: 193 LFLRVPLKNLFAWTSLISGLVQSGNEVDAFGLFIEMRREGVTIIDPLVLSSIIGASANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 MLELGKQVHGLVIGL 267 >ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X2 [Citrus sinensis] Length = 610 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/75 (54%), Positives = 51/75 (68%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 +F++ PV+NL W+AL+SGLVQS + AF MRRE D VDP +LSSIV AN A Sbjct: 193 IFEQAPVRNLFLWTALVSGLVQSRNEIDAFYSFIEMRREGVDIVDPLVLSSIVGACANFA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 VLELGKQIHGLVIAL 267 >ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X1 [Citrus sinensis] Length = 623 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/75 (54%), Positives = 51/75 (68%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 +F++ PV+NL W+AL+SGLVQS + AF MRRE D VDP +LSSIV AN A Sbjct: 193 IFEQAPVRNLFLWTALVSGLVQSRNEIDAFYSFIEMRREGVDIVDPLVLSSIVGACANFA 252 Query: 46 SLELGKQLHCFVLVL 2 LELGKQ+H V+ L Sbjct: 253 VLELGKQIHGLVIAL 267 >ref|XP_002520617.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540178|gb|EEF41753.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 344 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/75 (54%), Positives = 48/75 (64%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF PVKNL SW+ALISGLVQSG + MRRE D +DP +LSS+V AN A Sbjct: 193 LFSSFPVKNLYSWTALISGLVQSGKGIDGCYLFLEMRREGIDIIDPLVLSSVVGACANLA 252 Query: 46 SLELGKQLHCFVLVL 2 LE GKQLH ++ L Sbjct: 253 VLEFGKQLHGLIIAL 267 >ref|XP_002868318.1| hypothetical protein ARALYDRAFT_330113 [Arabidopsis lyrata subsp. lyrata] gi|297314154|gb|EFH44577.1| hypothetical protein ARALYDRAFT_330113 [Arabidopsis lyrata subsp. lyrata] Length = 1057 Score = 77.0 bits (188), Expect = 2e-12 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF +PVKNL SW+ALISG VQSG AF+V MRRE D +DP +LSSIV AN A Sbjct: 130 LFRRLPVKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLVLSSIVGACANLA 189 Query: 46 SLELGKQLHCFVLVL 2 + G+Q+H V+ L Sbjct: 190 ASIAGRQVHGLVIAL 204 >ref|XP_006414819.1| hypothetical protein EUTSA_v10024703mg [Eutrema salsugineum] gi|557115989|gb|ESQ56272.1| hypothetical protein EUTSA_v10024703mg [Eutrema salsugineum] Length = 609 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF E+P KNL SW+ALISG VQSG AF+V MRRE D +DP +LSSIV AN A Sbjct: 190 LFRELPAKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLVLSSIVGACANLA 249 Query: 46 SLELGKQLHCFVLVL 2 + G+Q+H V+ L Sbjct: 250 ASIAGRQVHGLVISL 264 >ref|NP_193141.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635650|sp|O23266.3|PP308_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14050, mitochondrial; Flags: Precursor gi|332657965|gb|AEE83365.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 612 Score = 75.9 bits (185), Expect = 5e-12 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF +PVKNL SW+ALISG VQSG AF+V MRRE D +DP +LSSIV AN A Sbjct: 193 LFRILPVKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLVLSSIVGACANLA 252 Query: 46 SLELGKQLHCFVLVL 2 + G+Q+H V+ L Sbjct: 253 ASIAGRQVHGLVIAL 267 >ref|XP_006283355.1| hypothetical protein CARUB_v10004398mg [Capsella rubella] gi|482552060|gb|EOA16253.1| hypothetical protein CARUB_v10004398mg [Capsella rubella] Length = 612 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/75 (53%), Positives = 50/75 (66%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF ++P KNL SW+ALISG VQSG AF+V MRRE D +DP +LSSIV AN A Sbjct: 193 LFRKLPAKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLVLSSIVGACANLA 252 Query: 46 SLELGKQLHCFVLVL 2 + G+Q+H V+ L Sbjct: 253 ASIAGRQVHGLVIGL 267 >ref|XP_002298671.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550348740|gb|EEE83476.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 634 Score = 74.3 bits (181), Expect = 2e-11 Identities = 40/73 (54%), Positives = 48/73 (65%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF PV+NL SW+ALISGLVQSG+ + MRRE D VDP +LSS+V AN A Sbjct: 217 LFLRTPVRNLYSWTALISGLVQSGYCIDGCYMFIEMRREGVDIVDPLVLSSVVGACANLA 276 Query: 46 SLELGKQLHCFVL 8 L LGKQ+H V+ Sbjct: 277 VLGLGKQIHGLVI 289 >ref|XP_003537521.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Glycine max] Length = 611 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/75 (50%), Positives = 49/75 (65%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF + P +NL +W+ALISGLVQSG+ AF++ MR E DP +LSS+V AN A Sbjct: 194 LFRQTPYRNLFAWTALISGLVQSGNGVDAFHLFVEMRHEGISVTDPLVLSSVVGACANLA 253 Query: 46 SLELGKQLHCFVLVL 2 ELGKQ+H V+ L Sbjct: 254 LWELGKQMHGVVITL 268 >pir||E71401 probable selenium-binding protein - Arabidopsis thaliana Length = 1070 Score = 73.6 bits (179), Expect = 3e-11 Identities = 40/74 (54%), Positives = 49/74 (66%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF +PVKNL SW+ALISG VQSG AF+V MRRE D +DP +LSSIV AN A Sbjct: 130 LFRILPVKNLYSWTALISGFVQSGKGLEAFSVFTEMRRERVDILDPLVLSSIVGACANLA 189 Query: 46 SLELGKQLHCFVLV 5 + G+Q+H L+ Sbjct: 190 ASIAGRQVHGNALI 203 >gb|ESW35800.1| hypothetical protein PHAVU_001G265800g [Phaseolus vulgaris] Length = 611 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/75 (48%), Positives = 49/75 (65%) Frame = -3 Query: 226 LFDEMPVKNLLSWSALISGLVQSGHVTGAFNVLNNMRREWDDGVDPYILSSIVAGAANQA 47 LF + P +NL +W+ALISGLVQSG+ A ++ MR + DP +LSS+V +N A Sbjct: 194 LFRQTPYRNLFAWTALISGLVQSGNGFEALHMFVEMRHDGVSVTDPLVLSSVVGACSNLA 253 Query: 46 SLELGKQLHCFVLVL 2 ELGKQ+HC V+ L Sbjct: 254 LWELGKQMHCLVIAL 268