BLASTX nr result
ID: Rheum21_contig00031171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031171 (403 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532433.1| Exocyst complex component, putative [Ricinus... 57 3e-06 gb|EXC03972.1| hypothetical protein L484_003892 [Morus notabilis] 56 6e-06 ref|XP_006383621.1| Exocyst complex component Sec5 family protei... 55 7e-06 >ref|XP_002532433.1| Exocyst complex component, putative [Ricinus communis] gi|223527853|gb|EEF29948.1| Exocyst complex component, putative [Ricinus communis] Length = 1094 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 403 LAQQCSSELLQAELMRTRLNAACFAESVPLD 311 LAQQCSSELLQAEL RTR+N ACF ES+PLD Sbjct: 1028 LAQQCSSELLQAELERTRINTACFVESIPLD 1058 >gb|EXC03972.1| hypothetical protein L484_003892 [Morus notabilis] Length = 1192 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 403 LAQQCSSELLQAELMRTRLNAACFAESVPLD 311 LAQQCSSELL+AEL RTR+N ACF ESVPLD Sbjct: 1121 LAQQCSSELLEAELERTRINTACFVESVPLD 1151 >ref|XP_006383621.1| Exocyst complex component Sec5 family protein [Populus trichocarpa] gi|550339447|gb|ERP61418.1| Exocyst complex component Sec5 family protein [Populus trichocarpa] Length = 1103 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 403 LAQQCSSELLQAELMRTRLNAACFAESVPLD 311 LAQQCSSELLQ+EL RTR+N ACF ES+PLD Sbjct: 1026 LAQQCSSELLQSELERTRINTACFVESIPLD 1056