BLASTX nr result
ID: Rheum21_contig00031065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031065 (453 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519596.1| conserved hypothetical protein [Ricinus comm... 81 2e-13 >ref|XP_002519596.1| conserved hypothetical protein [Ricinus communis] gi|223541228|gb|EEF42782.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 80.9 bits (198), Expect = 2e-13 Identities = 47/106 (44%), Positives = 59/106 (55%), Gaps = 4/106 (3%) Frame = +3 Query: 147 PPSTASCQNTPRQAPVST--DRARDVKYYKCGGRGHYKKDFPNSRRVLFSTTAAGYESCD 320 P T P Q P T D+ D YKCGGRGH +D PN ++VLFS A GYES + Sbjct: 9 PSETPKMAAAPSQPPYGTRQDKTSDKVCYKCGGRGHIVRDCPNPKKVLFS-QAMGYESFE 67 Query: 321 DEDQTLEPITKGTEE--EEDAYDCEPASLHAGTPLSLVTRRLLTVK 452 DE+ E ++ +++ Y C P L+ GTPLSLV R LTVK Sbjct: 68 DEEDNDEDPRNIYDDLADKEPYACGPPELNEGTPLSLVAHRALTVK 113