BLASTX nr result
ID: Rheum21_contig00031041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031041 (281 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384301.1| hypothetical protein POPTR_0004s12060g [Popu... 69 5e-10 ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation fa... 69 5e-10 ref|XP_002334768.1| predicted protein [Populus trichocarpa] 69 5e-10 ref|XP_002305359.1| predicted protein [Populus trichocarpa] 69 5e-10 gb|ESW23274.1| hypothetical protein PHAVU_004G033100g [Phaseolus... 69 6e-10 gb|EMJ16113.1| hypothetical protein PRUPE_ppa000705mg [Prunus pe... 69 6e-10 ref|XP_003554717.1| PREDICTED: probable ubiquitin conjugation fa... 69 6e-10 ref|XP_003543890.1| PREDICTED: probable ubiquitin conjugation fa... 69 6e-10 ref|XP_002324089.1| U-box domain-containing family protein [Popu... 69 6e-10 ref|XP_004489437.1| PREDICTED: probable ubiquitin conjugation fa... 68 1e-09 ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus ... 68 1e-09 ref|XP_006482712.1| PREDICTED: probable ubiquitin conjugation fa... 67 2e-09 ref|XP_006347208.1| PREDICTED: probable ubiquitin conjugation fa... 67 2e-09 ref|XP_006338399.1| PREDICTED: probable ubiquitin conjugation fa... 67 2e-09 ref|XP_006431253.1| hypothetical protein CICLE_v10010958mg [Citr... 67 2e-09 ref|XP_006431252.1| hypothetical protein CICLE_v10010958mg [Citr... 67 2e-09 ref|XP_006431249.1| hypothetical protein CICLE_v10010958mg [Citr... 67 2e-09 ref|XP_006431248.1| hypothetical protein CICLE_v10010958mg [Citr... 67 2e-09 gb|EOY03576.1| U-box domain-containing protein isoform 1 [Theobr... 67 2e-09 ref|XP_004232186.1| PREDICTED: probable ubiquitin conjugation fa... 67 2e-09 >ref|XP_006384301.1| hypothetical protein POPTR_0004s12060g [Populus trichocarpa] gi|550340866|gb|ERP62098.1| hypothetical protein POPTR_0004s12060g [Populus trichocarpa] Length = 1020 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQVPLMC 164 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ C Sbjct: 446 KSKYSFICECFFMTARVLNLGLLKAFSDFKHLVQEISRC 484 >ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Vitis vinifera] gi|296082973|emb|CBI22274.3| unnamed protein product [Vitis vinifera] Length = 1037 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQVPLMCH*SV 152 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ C S+ Sbjct: 462 KAKYSFICECFFMTARVLNLGLLKAFSDFKHLVQDISRCEDSL 504 >ref|XP_002334768.1| predicted protein [Populus trichocarpa] Length = 273 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQVPLMC 164 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ C Sbjct: 40 KSKYSFICECFFMTARVLNLGLLKAFSDFKHLVQEISRC 78 >ref|XP_002305359.1| predicted protein [Populus trichocarpa] Length = 930 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQVPLMC 164 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ C Sbjct: 446 KSKYSFICECFFMTARVLNLGLLKAFSDFKHLVQEISRC 484 >gb|ESW23274.1| hypothetical protein PHAVU_004G033100g [Phaseolus vulgaris] Length = 1042 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 468 KTKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 501 >gb|EMJ16113.1| hypothetical protein PRUPE_ppa000705mg [Prunus persica] Length = 1028 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 454 KAKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 487 >ref|XP_003554717.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Glycine max] Length = 1036 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 464 KTKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 497 >ref|XP_003543890.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Glycine max] Length = 1038 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 466 KTKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 499 >ref|XP_002324089.1| U-box domain-containing family protein [Populus trichocarpa] gi|222867091|gb|EEF04222.1| U-box domain-containing family protein [Populus trichocarpa] Length = 1019 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 445 KAKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 478 >ref|XP_004489437.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Cicer arietinum] Length = 1030 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 + KYSFICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 455 RAKYSFICECFFMTARVLNLGLLKAFSDFKHLVQ 488 >ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527331|gb|EEF29477.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1031 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY+FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 457 KAKYTFICECFFMTARVLNLGLLKAFSDFKHLVQ 490 >ref|XP_006482712.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Citrus sinensis] Length = 1049 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 474 KSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_006347208.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Solanum tuberosum] Length = 1019 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 465 KAKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 498 >ref|XP_006338399.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Solanum tuberosum] Length = 1040 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 466 KAKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 499 >ref|XP_006431253.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533310|gb|ESR44493.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 732 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 204 KSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 237 >ref|XP_006431252.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533309|gb|ESR44492.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 779 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 204 KSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 237 >ref|XP_006431249.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533306|gb|ESR44489.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 1049 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 474 KSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >ref|XP_006431248.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] gi|557533305|gb|ESR44488.1| hypothetical protein CICLE_v10010958mg [Citrus clementina] Length = 1002 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 474 KSKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 507 >gb|EOY03576.1| U-box domain-containing protein isoform 1 [Theobroma cacao] gi|508711680|gb|EOY03577.1| U-box domain-containing protein isoform 1 [Theobroma cacao] Length = 1042 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 468 KAKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 501 >ref|XP_004232186.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Solanum lycopersicum] Length = 1040 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 280 KPKYSFICECFFMTARVLNLGLLKAFYDFKHLVQ 179 K KY FICECFFMTARVLNLGLLKAF DFKHLVQ Sbjct: 466 KAKYPFICECFFMTARVLNLGLLKAFSDFKHLVQ 499