BLASTX nr result
ID: Rheum21_contig00031032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00031032 (275 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61979.1| hypothetical protein L484_002759 [Morus notabilis] 61 2e-07 ref|XP_002509931.1| hypothetical protein RCOM_1691130 [Ricinus c... 57 3e-06 ref|XP_002320184.2| hypothetical protein POPTR_0014s09130g [Popu... 57 3e-06 >gb|EXB61979.1| hypothetical protein L484_002759 [Morus notabilis] Length = 135 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/61 (47%), Positives = 40/61 (65%) Frame = +3 Query: 39 LIKKTKPPTQNDAVRGSEGVETLRVWDCGSPLYDVHELVSVSFIIEKHLMLLPGASDSKR 218 ++K+T + D E L +WDCGSPLYD +ELVS+S +IE+HLM+LP S+R Sbjct: 1 MMKRTSKVQEEDHKEEKE--LELAIWDCGSPLYDSYELVSLSHLIERHLMILPSLGGSRR 58 Query: 219 F 221 F Sbjct: 59 F 59 >ref|XP_002509931.1| hypothetical protein RCOM_1691130 [Ricinus communis] gi|223549830|gb|EEF51318.1| hypothetical protein RCOM_1691130 [Ricinus communis] Length = 127 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 111 VWDCGSPLYDVHELVSVSFIIEKHLMLLPGASDSKRF 221 VWDCGSPLYD +E+ SV +IE+H+M LP + SKRF Sbjct: 15 VWDCGSPLYDSYEIASVGHVIERHMMALPSSCGSKRF 51 >ref|XP_002320184.2| hypothetical protein POPTR_0014s09130g [Populus trichocarpa] gi|550323810|gb|EEE98499.2| hypothetical protein POPTR_0014s09130g [Populus trichocarpa] Length = 128 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/60 (41%), Positives = 38/60 (63%) Frame = +3 Query: 66 QNDAVRGSEGVETLRVWDCGSPLYDVHELVSVSFIIEKHLMLLPGASDSKRFKAHLRGPA 245 + D + + +TL +WD GSPLYD +E+VS++ +IE+ LM LP SKR + + PA Sbjct: 8 KKDGLERKQEEKTLAIWDLGSPLYDSYEVVSLTHLIERQLMTLPSLGGSKRLSSKIFSPA 67