BLASTX nr result
ID: Rheum21_contig00030257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00030257 (335 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313516.2| hypothetical protein POPTR_0009s01800g [Popu... 60 2e-07 gb|EXB74665.1| hypothetical protein L484_007671 [Morus notabilis] 56 4e-06 ref|NP_200860.1| late embryogenesis abundant protein-like protei... 56 6e-06 ref|XP_004251121.1| PREDICTED: uncharacterized protein LOC101254... 55 7e-06 >ref|XP_002313516.2| hypothetical protein POPTR_0009s01800g [Populus trichocarpa] gi|550330833|gb|EEE87471.2| hypothetical protein POPTR_0009s01800g [Populus trichocarpa] Length = 389 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -1 Query: 149 MLPRRGKQERAICSAEGRCLNEVVTCPAECPERRPPGMSQRKACVVDC 6 + P QERA C A+G C N++V CPA+CPE++P + KAC VDC Sbjct: 91 LTPLGSGQERAQCKAKGHCKNKIVVCPAQCPEKKPKKNKKHKACFVDC 138 >gb|EXB74665.1| hypothetical protein L484_007671 [Morus notabilis] Length = 392 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -1 Query: 128 QERAICSAEGRCLNEVVTCPAECPERRPPGMSQRKACVVDC 6 QERA C G+C ++ +TCPAECP R+P ++K C VDC Sbjct: 98 QERAKCKKSGKCKSKTLTCPAECPHRKPKNNKKKKGCYVDC 138 >ref|NP_200860.1| late embryogenesis abundant protein-like protein [Arabidopsis thaliana] gi|9757754|dbj|BAB08235.1| unnamed protein product [Arabidopsis thaliana] gi|40823110|gb|AAR92259.1| At5g60520 [Arabidopsis thaliana] gi|332009956|gb|AED97339.1| late embryogenesis abundant protein-like protein [Arabidopsis thaliana] Length = 338 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = -1 Query: 149 MLPRRGKQERAICSAEGRCLNEVVTCPAECPERRPPGMSQRKACVVDC 6 + P QER C A G C +++TCP ECPER+P ++KAC +DC Sbjct: 41 LYPLGSGQERVQCLARGSCNQKILTCPKECPERKPKMNKKKKACFIDC 88 >ref|XP_004251121.1| PREDICTED: uncharacterized protein LOC101254662 [Solanum lycopersicum] Length = 342 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/52 (46%), Positives = 32/52 (61%) Frame = -1 Query: 161 NGLRMLPRRGKQERAICSAEGRCLNEVVTCPAECPERRPPGMSQRKACVVDC 6 N L LP G QERA C+ +G C +TCP ECP+R+P ++K C +DC Sbjct: 44 NVLDPLPGTG-QERAFCTVQGVCYYRTLTCPTECPQRKPKQNKKQKGCYIDC 94