BLASTX nr result
ID: Rheum21_contig00029962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029962 (302 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [M... 65 9e-09 ref|XP_004290393.1| PREDICTED: B3 domain-containing transcriptio... 65 1e-08 gb|EMJ01055.1| hypothetical protein PRUPE_ppa006275mg [Prunus pe... 62 8e-08 gb|EMJ01054.1| hypothetical protein PRUPE_ppa006275mg [Prunus pe... 62 8e-08 emb|CAN82368.1| hypothetical protein VITISV_027619 [Vitis vinifera] 62 8e-08 ref|XP_006350211.1| PREDICTED: B3 domain-containing protein At3g... 61 1e-07 emb|CAN71750.1| hypothetical protein VITISV_040593 [Vitis vinifera] 61 1e-07 ref|XP_006479394.1| PREDICTED: B3 domain-containing transcriptio... 60 2e-07 ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citr... 60 2e-07 ref|XP_002281517.1| PREDICTED: B3 domain-containing transcriptio... 60 2e-07 emb|CBI32503.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_006357562.1| PREDICTED: B3 domain-containing transcriptio... 60 3e-07 ref|XP_004245425.1| PREDICTED: B3 domain-containing transcriptio... 60 3e-07 ref|XP_004243797.1| PREDICTED: B3 domain-containing transcriptio... 60 3e-07 ref|XP_003529203.1| PREDICTED: B3 domain-containing transcriptio... 60 3e-07 gb|ACU18995.1| unknown [Glycine max] 60 3e-07 gb|ESW25147.1| hypothetical protein PHAVU_003G011300g [Phaseolus... 60 4e-07 ref|XP_004236626.1| PREDICTED: B3 domain-containing protein At3g... 60 4e-07 ref|XP_004236625.1| PREDICTED: B3 domain-containing protein At3g... 60 4e-07 ref|XP_002519145.1| DNA binding protein, putative [Ricinus commu... 60 4e-07 >gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [Morus notabilis] Length = 467 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQDFVE+++I+ GYFL+FRYEG S F V IF+LST EI Y Sbjct: 111 GWQDFVERYAIRAGYFLIFRYEGNSTFHVYIFNLSTSEINY 151 >ref|XP_004290393.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Fragaria vesca subsp. vesca] Length = 419 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQDF+E++SI+ GYFL+FRYEG S F V IF+L+T EI Y Sbjct: 65 GWQDFIERYSIRIGYFLIFRYEGNSSFIVNIFNLTTAEINY 105 >gb|EMJ01055.1| hypothetical protein PRUPE_ppa006275mg [Prunus persica] Length = 420 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ+F+E++SI+ GYFL FRYEG S F V IF+L+T EI Y Sbjct: 67 GWQEFIERYSIRVGYFLTFRYEGHSSFTVHIFNLTTAEINY 107 >gb|EMJ01054.1| hypothetical protein PRUPE_ppa006275mg [Prunus persica] Length = 391 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ+F+E++SI+ GYFL FRYEG S F V IF+L+T EI Y Sbjct: 67 GWQEFIERYSIRVGYFLTFRYEGHSSFTVHIFNLTTAEINY 107 >emb|CAN82368.1| hypothetical protein VITISV_027619 [Vitis vinifera] Length = 641 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ+F E HSI GYFL+F YEG S+F + IFDL+T EI Y Sbjct: 363 GWQEFAEHHSILXGYFLVFEYEGNSNFKISIFDLTTCEISY 403 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ+F E HSI CGYFL+F YEG S+F V +FDL+ EI Y Sbjct: 72 GWQEFAEHHSIGCGYFLVFGYEGVSNFRVSVFDLTACEIRY 112 >ref|XP_006350211.1| PREDICTED: B3 domain-containing protein At3g18960-like [Solanum tuberosum] Length = 228 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW F E +SI CGYFLLFRY+G S F V IFDLS EIEY Sbjct: 111 GWNKFKEYYSIACGYFLLFRYKGNSQFSVFIFDLSASEIEY 151 >emb|CAN71750.1| hypothetical protein VITISV_040593 [Vitis vinifera] Length = 617 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ FVE +SI+ GYFLLFRYEG S F V +FD++ EIEY Sbjct: 348 GWQQFVEHYSIEYGYFLLFRYEGDSHFHVLVFDMTASEIEY 388 >ref|XP_006479394.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 416 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW +F+E SI+ GYF++FRY+G SDF+V I+DL+ EIEY Sbjct: 90 GWHEFIEHCSIRAGYFMIFRYQGNSDFNVYIYDLANSEIEY 130 >ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] gi|557525042|gb|ESR36348.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] Length = 426 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW +F+E SI+ GYF++FRY+G SDF+V I+DL+ EIEY Sbjct: 90 GWHEFIEHCSIRAGYFMIFRYQGNSDFNVYIYDLANSEIEY 130 >ref|XP_002281517.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Vitis vinifera] Length = 407 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW +FVE +SI GYFL+FRYEG S+F+V IFDL+ EI Y Sbjct: 83 GWHEFVEYYSIHVGYFLIFRYEGNSNFNVNIFDLTASEINY 123 >emb|CBI32503.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW +FVE +SI GYFL+FRYEG S+F+V IFDL+ EI Y Sbjct: 83 GWHEFVEYYSIHVGYFLIFRYEGNSNFNVNIFDLTASEINY 123 >ref|XP_006357562.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Solanum tuberosum] Length = 584 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEYAKKGH 163 GWQ+F+E HS+ C YFLLF+Y S F+V IFDL+ EI+Y + H Sbjct: 72 GWQEFMEHHSVNCWYFLLFKYGQTSCFNVHIFDLAATEIDYQLRSH 117 >ref|XP_004245425.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Solanum lycopersicum] Length = 296 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEYAKKGH 163 GWQ+F+E HS+ C YFLLF+Y S F+V IFDL+ EI+Y + H Sbjct: 71 GWQEFMEHHSVNCWYFLLFKYGQTSCFNVHIFDLAATEIDYQLRSH 116 >ref|XP_004243797.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Solanum lycopersicum] Length = 630 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEYAKKGH 163 GWQ+F+E HS+ C YFLLF+Y S F+V IFDL+ EI+Y + H Sbjct: 71 GWQEFMEHHSVNCWYFLLFKYGQTSCFNVHIFDLAATEIDYQLRSH 116 >ref|XP_003529203.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Glycine max] Length = 437 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQDFV+++SI GYFL+F YEG S F V IF+LST E+ Y Sbjct: 64 GWQDFVQRYSIGVGYFLVFMYEGNSSFIVHIFNLSTSEVNY 104 >gb|ACU18995.1| unknown [Glycine max] Length = 437 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQDFV+++SI GYFL+F YEG S F V IF+LST E+ Y Sbjct: 64 GWQDFVQRYSIGVGYFLVFMYEGNSSFIVHIFNLSTSEVNY 104 >gb|ESW25147.1| hypothetical protein PHAVU_003G011300g [Phaseolus vulgaris] Length = 435 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQDFV+++S+ GYFL+F YEG S F V IF+LST E+ Y Sbjct: 64 GWQDFVQRYSVGVGYFLVFMYEGNSSFIVHIFNLSTAELNY 104 >ref|XP_004236626.1| PREDICTED: B3 domain-containing protein At3g18960-like isoform 2 [Solanum lycopersicum] Length = 228 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW F E +SI CGYFLLFRY+G S F V IFDLS EIEY Sbjct: 111 GWNKFKEYYSIGCGYFLLFRYKGNSQFCVFIFDLSASEIEY 151 >ref|XP_004236625.1| PREDICTED: B3 domain-containing protein At3g18960-like isoform 1 [Solanum lycopersicum] Length = 239 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GW F E +SI CGYFLLFRY+G S F V IFDLS EIEY Sbjct: 122 GWNKFKEYYSIGCGYFLLFRYKGNSQFCVFIFDLSASEIEY 162 >ref|XP_002519145.1| DNA binding protein, putative [Ricinus communis] gi|223541808|gb|EEF43356.1| DNA binding protein, putative [Ricinus communis] Length = 333 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 300 GWQDFVEKHSIKCGYFLLFRYEGGSDFDVQIFDLSTLEIEY 178 GWQ+F+E++SI+ GYFL+FRYEG S F V IF+LS EI Y Sbjct: 64 GWQEFMERYSIRVGYFLVFRYEGHSVFTVHIFNLSASEINY 104