BLASTX nr result
ID: Rheum21_contig00029795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029795 (251 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520624.1| sentrin/sumo-specific protease, senp8, putat... 66 4e-09 >ref|XP_002520624.1| sentrin/sumo-specific protease, senp8, putative [Ricinus communis] gi|223540185|gb|EEF41760.1| sentrin/sumo-specific protease, senp8, putative [Ricinus communis] Length = 254 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/93 (37%), Positives = 49/93 (52%), Gaps = 14/93 (15%) Frame = +1 Query: 10 GSHWSLLVYCRTIHLFFHHDSLGGINHVRARKLYENVK--------------NLVGYGGK 147 G+HWSLLV+CR +++F HHDS GIN+ RA +LY+ VK VG G Sbjct: 104 GTHWSLLVFCREMNMFVHHDSCHGINYFRAVELYDVVKEHVRRYSKSPDTPPEEVGCGSD 163 Query: 148 GKQLRKSSGKNKRRRAEACFFESFTPVEAYGYD 246 + +K K K+++ E TP + GYD Sbjct: 164 SEFPKKKKKKKKKKKNRQYIMEGRTPQQTNGYD 196