BLASTX nr result
ID: Rheum21_contig00029556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00029556 (728 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 102 1e-19 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 102 bits (255), Expect = 1e-19 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -3 Query: 606 ERGGYLAGVVSVVCHEVPMDKGTSEFSLLGAGSLLPSIPLHSIVSYCTVPYQ 451 ERGGY+AGVVSVVCHEVPMDKGTSE SLLGAGS LPSIPLHSIVSYCTVPYQ Sbjct: 199 ERGGYIAGVVSVVCHEVPMDKGTSESSLLGAGSPLPSIPLHSIVSYCTVPYQ 250 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 124 EDIRGSSEWRFSCREPDEGRPSRPVRRAGISRPYYHYAFAM 2 +DIRGSSEWRF CREPDEGRPSRPVRRAGISRPYYHYAFAM Sbjct: 258 KDIRGSSEWRFPCREPDEGRPSRPVRRAGISRPYYHYAFAM 298